DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPRD and Ptp10D

DIOPT Version :9

Sequence 1:NP_001364887.1 Gene:PTPRD / 5789 HGNCID:9668 Length:1932 Species:Homo sapiens
Sequence 2:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster


Alignment Length:1687 Identity:399/1687 - (23%)
Similarity:647/1687 - (38%) Gaps:445/1687 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   236 PRFSIPPTNHEI--------------MPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMP--- 283
            |.|..|..|..|              :||...|.......  ..:..|:.....:|...|.|   
  Fly    67 PPFGYPEPNTTIASREIGDEIQFSRALPGTKYNFWLYYTN--FTHHDWLTWTVTITTAPDPPSNL 129

Human   284 -----IGRNVLELNDVRQSANYTCVAMSTLGVIEAIA-------------QITVKAL-------- 322
                 .|:|.:.|.......:||...:..||:.||.:             |.:||.|        
  Fly   130 SVQVRSGKNAIILWSPPTQGSYTAFKIKVLGLSEASSSYNRTFQVNDNTFQHSVKELTPGATYQV 194

Human   323 ----------------------PKPPGTPVVTESTATSITLTWDSGNPEPV-SYYIIQHKP--KN 362
                                  |..||..:|.....|::.:.|....|..: ::|.:..:|  .|
  Fly   195 QAYTIYDGKESVAYTSRNFTTKPNTPGKFIVWFRNETTLLVLWQPPYPAGIYTHYKVSIEPPDAN 259

Human   363 SEELYKEIDG-------------VATTRYSVA--------------------------------- 381
            ...||.|.:|             |....|:::                                 
  Fly   260 DSVLYVEKEGEPPGPAQAAFKGLVPGRAYNISVQTMSEDEISLPTTAQYRTVPLRPLNVTFDRDF 324

Human   382 --------------GLSPYSDYEFRVVAVNNIGRGPPS-------------EP-----VLTQTSE 414
                          |:|.:..|:..|.........|.|             ||     |:.:|..
  Fly   325 ITSNSFRVLWEAPKGISEFDKYQVSVATTRRQSTVPRSNEPVAFFDFRDIAEPGKTFNVIVKTVS 389

Human   415 QAPSSAPR--DVQARML-----------SSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNW 466
            ...:|.|.  ||..|.|           .:.|:::.|:  .:|......||:.|  ...:..|..
  Fly   390 GKVTSWPATGDVTLRPLPVRNLRSINDDKTNTMIITWE--ADPASTQDEYRIVY--HELETFNGD 450

Human   467 MKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPL--NFKAEPESE 529
            ......|....|:.:|:|.:.||:.|.|.:...:...:| |.|:|:   |..|:  :.|:   ..
  Fly   451 TSTLTTDRTRFTLESLLPGRNYSLSVQAVSKKMESNETS-IFVVTR---PSSPIIEDLKS---IR 508

Human   530 TSILLSWTPPRSDTIANYELVY-KDG------EHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAA 587
            ..:.:||....:.....||::| ::|      :..:|.|:.|        :.|:|.:.|..::.|
  Fly   509 MGLNISWKSDVNSKQEQYEVLYSRNGTSDLRTQKTKESRLVI--------KNLQPGAGYELKVFA 565

Human   588 RSPQGLGASTAEISARTMQSKPSA--------PPQDISCTSPSSTSILVSWQPPPVEKQNGIITE 644
            .|             ..::|:|.|        ||::::..:..|.|:||.|.||    ::|..||
  Fly   566 VS-------------HDLRSEPHAYFQAVYPNPPRNMTIETVRSNSVLVHWSPP----ESGEFTE 613

Human   645 YSIKYTAVDGEDDKPHEILGIPS-DTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNE 708
            |||:|     ..|...:.:.:|| .:|:..:..:.|..:|.|.|..   |..|.|| .|....|.
  Fly   614 YSIRY-----RTDSEQQWVRLPSVRSTEADITDMTKGEKYTIQVNT---VSFGVES-PVPQEVNT 669

Human   709 DVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMEN---------GEPKGQPM 764
            .||..|...: ::.|:|.::.:.|..|     .|::..|.:.:...:|         .|.|....
  Fly   670 TVPPNPVSNI-IQLVDSRNITLEWPKP-----EGRVESYILKWWPSDNPGRVQTKNVSENKSADD 728

Human   765 LKDV------MLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAV 823
            |..|      ::...|::||..|....|:||:         .:.|      .|:.|.:.|.....
  Fly   729 LSTVRVLIGELMPGVQYKFDIQTTSYGILSGI---------TSLY------PRTMPLIQSDVVVA 778

Human   824 PGKPRLVINHTQMNTALIQWHPPVDTFGPLQGYRLKFGR---KDMEPLTTLEFSEKEDHFTATDI 885
            .|:     ...:.:|..:.:.|...:......||...|.   :|.|.|.    ::.:...|.|.:
  Fly   779 NGE-----KEDERDTITLSYTPTPQSSSKFDIYRFSLGDAEIRDKEKLA----NDTDRKVTFTGL 834

Human   886 HKGASY---VFRLSARNKVGFGEEMVKEISI-------PEEVPTGFPQNLHSEGTTSTSVQLSWQ 940
            ..|..|   |:.:|..         |..:.|       ||.:     ..||:...|.|.:.|.|.
  Fly   835 VPGRLYNITVWTVSGG---------VASLPIQRQDRLYPEPI-----TQLHATNITDTEISLRWD 885

Human   941 PPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTT---MTLTGLKP--DTTYDVKVRAHTS- 999
            .|     .|       .|.|.:|..|..:.|:....||   :|::.|:|  :.|:.|.||:.|. 
  Fly   886 LP-----KG-------EYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVVVRSGTES 938

Human  1000 ---KGPGPYSPSVQFRTLPVDQAV--FAKNFHVKAVMKTSVLLSWEIPENYNSAM--PFKILY-- 1055
               :...|.|.|  |.|   ::||  ..:.||...|..:.:...|.:|.:..:.:  .|.|.|  
  Fly   939 SVLRSSSPLSAS--FTT---NEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTN 998

Human  1056 -----DDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAF 1115
                 |.|  :::.:......:|.||||.::|.|.:..: .:.|....|...:|.|.:...:|| 
  Fly   999 INNLTDAG--MQDFESEEAFGVIKNLKPGETYVFKIQAK-TAIGFGPEREYRQTMPILAPPRPA- 1059

Human  1116 IGKTNLDGMITVQLP-EV-----------------PANENIKGYYIIIV--PLKKSRGKFIKPWE 1160
                      |..:| ||                 ..|..::.|.||:.  ..|.:.|..:..| 
  Fly  1060 ----------TQVVPTEVYRSSSTIQIRFRKNYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSW- 1113

Human  1161 SPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTE-FTLGD---DKHYGGFTNKQLQ 1221
                  ||.....:....::|        .||..  |:....| ||:|.   |.|..|:.|..|:
  Fly  1114 ------LDVQSYSVWLPYQAI--------DPYYP--FENRSVEDFTIGTENCDNHKIGYCNGPLK 1162

Human  1222 SGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEEGLIWVVGPVLAVVFIICIVI 1286
            ||..|...|.|        ......::|...|.     ||..:::....:|...:.:..|:.:::
  Fly  1163 SGTTYRVKVRA--------FTGADKFTDTAYSF-----PIQTDQDNTSLIVAITVPLTIILVLLV 1214

Human  1287 AILLYKSSKPDRKRAESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPGSDDSGYPGNLHSSSM 1351
            .:|.||..:.:.::...|||.:   :|..:|                              .|.:
  Fly  1215 TLLFYKRRRNNCRKTTKDSRAN---DNMSLP------------------------------DSVI 1246

Human  1352 ASHPPIPILELADHIERLKANDNLKFSQEYESI-DPGQQFTWEHSNLEVNKPKNRYANVIAYDHS 1415
            ..:.||.|...|:|...:.|:.:.:||:|:|.: ..|:......::|..|:||||:.|::.||||
  Fly  1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCTFADLPCNRPKNRFTNILPYDHS 1311

Human  1416 RVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEER 1480
            |..|..::...||||:||||:.|:.....:|.|||.|..|..|||||.||..|..:||:|:..|:
  Fly  1312 RFKLQPVDDDEGSDYINANYVPGHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEK 1376

Human  1481 SRVKCDQYWPSRGTET-HGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGV 1544
            .|.|||||||:..... :|.::|.:|:....|.:.:..|.|.:  .||:|.:|.|.||.|||.||
  Fly  1377 GREKCDQYWPNDTVPVFYGDIKVQILNDSHYADWVMTEFMLCR--GSEQRILRHFHFTTWPDFGV 1439

Human  1545 PEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMR 1609
            |..|...:.|:|..:.....:..|:||||||||||:|.||.:|.:|::|.....|||:|.|..||
  Fly  1440 PNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQINTSDYVDIFGIVYAMR 1504

Human  1610 AQRNYMVQTEDQYIFIHDALLEAVTCGNTEV--PARNLY---AYIQKLTQI-ETGENVTGME 1665
            .:|.:|||||.|||.||..|| ||..|...:  |||.::   .|..:..|: |.|:.|..:|
  Fly  1505 KERVWMVQTEQQYICIHQCLL-AVLEGKENIVGPAREMHDNEGYEGQQVQLDENGDVVATIE 1565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPRDNP_001364887.1 I-set 24..115 CDD:400151
Ig strand A' 32..36 CDD:409353
Ig strand B 39..48 CDD:409353
Ig strand C 54..59 CDD:409353
Ig strand C' 62..65 CDD:409353
Ig strand D 68..75 CDD:409353
Ig strand E 76..86 CDD:409353
Ig strand F 94..102 CDD:409353
Ig strand G 105..115 CDD:409353
IgI_2_RPTP_IIa_LAR_like 127..226 CDD:409400
Ig strand B 143..147 CDD:409400
Ig strand C 156..160 CDD:409400
Interaction with IL1RAPL1. /evidence=ECO:0000250 180..189
Mini-exon peptide A9, sufficient for interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:Q64487 181..189
Ig strand E 190..194 CDD:409400
Ig strand F 204..209 CDD:409400
Ig strand G 216..219 CDD:409400
Mini-exon peptide B, required for interaction with SLITRK2 and in the function in pre-synaptic differentiation, Acts as an adjustable linker to control relative positions and orientations of the PTPRD second and third immunoglobilin domains for their simultaneous interactions with the first immunoglobilin domain of IL1RAPL1 and IL1RAP, Modulates affinity for IL1RAPL1 and IL1RAP. /evidence=ECO:0000250|UniProtKB:Q64487 227..230
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401 20/115 (17%)
Ig strand B 253..257 CDD:409401 1/3 (33%)
Ig strand C 266..270 CDD:409401 0/3 (0%)
Ig strand E 287..291 CDD:409401 1/3 (33%)
Ig strand F 299..304 CDD:409401 2/4 (50%)
Ig strand G 312..315 CDD:409401 2/2 (100%)
FN3 323..412 CDD:238020 25/169 (15%)
FN3 419..511 CDD:238020 24/104 (23%)
FN3 516..604 CDD:238020 17/96 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 603..623 5/27 (19%)
FN3 612..706 CDD:238020 29/94 (31%)
FN3 713..819 CDD:238020 22/120 (18%)
FN3 824..919 CDD:238020 19/107 (18%)
FN3 922..1013 CDD:238020 27/99 (27%)
FN3 1023..>1084 CDD:238020 16/69 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1304..1324 5/19 (26%)
R-PTPc-D-1 1354..1637 CDD:350472 120/284 (42%)
Substrate binding. /evidence=ECO:0000250 1573..1579 5/5 (100%)
R-PTP-D-2 1638..1929 CDD:350476 9/34 (26%)
Ptp10DNP_996413.2 fn3 124..205 CDD:278470 15/80 (19%)
fn3 220..304 CDD:278470 15/83 (18%)
fn3 315..391 CDD:278470 10/75 (13%)
FN3 405..494 CDD:238020 19/93 (20%)
FN3 511..574 CDD:238020 15/83 (18%)
FN3 583..671 CDD:238020 30/100 (30%)
fn3 683..753 CDD:278470 15/74 (20%)
fn3 787..850 CDD:278470 14/66 (21%)
fn3 866..935 CDD:278470 22/85 (26%)
fn3 961..1043 CDD:278470 18/84 (21%)
PTPc 1272..1525 CDD:214550 110/254 (43%)
PTPc 1298..1525 CDD:238006 103/228 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3031
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.