DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Angptl4 and CG31832

DIOPT Version :9

Sequence 1:NP_065606.2 Gene:Angptl4 / 57875 MGIID:1888999 Length:410 Species:Mus musculus
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:223 Identity:79/223 - (35%)
Similarity:115/223 - (51%) Gaps:26/223 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse   195 LFQEGERH---------SGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKD 250
            ||:.|:..         :|:.|:......||.|....|:...|.||||||:|||:|||||.:|||
  Fly    14 LFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKD 78

Mouse   251 GFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQF-PIHLGGEDTAYSLQLT---EP 311
            |||||.|||::||:|::.:|..:..:|.:||:...|......| ...:..|...|.|:..   ..
  Fly    79 GFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSG 143

Mouse   312 TANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQ 376
            ||.:....:::..     |||:|:|:| ....|||....|||||.:|..|:|||.||    |:.:
  Fly   144 TAGDSLRYHINKR-----FSTFDRDND-ESSKNCAAEHGGGWWFHSCLSSSLNGLYF----REGE 198

Mouse   377 E-RKKGIFWKTWKGRYYPLQATTLLIQP 403
            . ...||.|..||  :..|....::|:|
  Fly   199 TGMLNGIHWGRWK--FQSLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Angptl4NP_065606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..101
Fib_alpha <104..133 CDD:285864
FReD 187..404 CDD:238040 79/223 (35%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/209 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.