DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM3 and dpr21

DIOPT Version :9

Sequence 1:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:221 Identity:48/221 - (21%)
Similarity:76/221 - (34%) Gaps:39/221 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   118 TSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQ-QTLYFGEKRALRDNRI-QLVTSTPHELSISI 180
            |.:.|.:.|.|..|.|::|:..:.::.|..... ..|...|.....|.|. .:......:.|:.|
  Fly    58 TKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQI 122

Human   181 SNVALADEGEYTCSI-------FTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSS 238
            ....|.|.|.|.|.:       :||.....:.:.::||.|:..|..|        .|..|.|...
  Fly   123 KFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLG--------STVNLTCVIK 179

Human   239 G-SKPAARLTWRKGDQELHGEPTRIQEDPNG-------KTFTVSSSVTFQVTREDDGASIVC--- 292
            . ..|...:.|...:||::      .:.|.|       |....:|.:..|.....|.....|   
  Fly   180 HLPDPPISVQWNHNNQEIN------YDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPS 238

Human   293 -----SVNHESLKGADRSTSQRIEVL 313
                 |||...|||...:..|:..:|
  Fly   239 NANSKSVNVHILKGDHPAAVQKSHLL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM3XP_024304528.1 Ig1_Necl-1 115..209 CDD:143290 21/99 (21%)
Ig2_Necl-1 230..312 CDD:143329 21/97 (22%)
IG_like 328..399 CDD:214653
4.1m 437..452 CDD:128590
dpr21NP_001163838.2 Ig 71..149 CDD:299845 17/77 (22%)
IG_like 71..140 CDD:214653 15/68 (22%)
IG_like 162..249 CDD:214653 20/100 (20%)
IGc2 169..242 CDD:197706 15/86 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.