DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF410 and lmd

DIOPT Version :9

Sequence 1:NP_001229853.1 Gene:ZNF410 / 57862 HGNCID:20144 Length:516 Species:Homo sapiens
Sequence 2:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster


Alignment Length:590 Identity:127/590 - (21%)
Similarity:203/590 - (34%) Gaps:193/590 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    30 ESEAKDITCLSLLPVTEASECSRLMLPEPVP------------WREEDGKSGCSDLNDTTNHSNS 82
            |.:.|:....:.||    |..|....|:.:|            :::..|.|       |.|:.|:
  Fly   251 EEQVKEEASPAKLP----SMNSTFGTPKCIPMCASNYEDYANLYQQGSGYS-------TENYHNN 304

Human    83 SKEVPSSAVLRSLRVNVGPDGEETRAQTVQKSPEFLSTSESSSLLQDLQPSDSTSFILLNLTRAG 147
            ..:|...           |:.|.....|:.:             |.:|...:...|:..:|.:..
  Fly   305 MAQVVEK-----------PNREHKAIWTIDE-------------LDELMLGEQQQFLQHHLQQQH 345

Human   148 LGSSAEHLVFVQDEAEDSGN------DFLSSESTDSSIPWFLRVQELAHDSLIAATRAQLAKNAK 206
            |....|.|.....:.:.:.|      ::||.|        |::.:|.               .:.
  Fly   346 LQEQQEQLHQPHGQEQQTQNCKDDLVNYLSDE--------FIKAEEF---------------RSL 387

Human   207 TSSNGENVHLGSGD------GQSKDSGPL-------PQVEKK-----LKCTVEGCDRTFVWPAHF 253
            .|.:.||.:....|      ....:|.|.       |:.|.:     |.|...|||..|.....|
  Fly   388 DSDDDENYNEEEDDLDNDVFAPPAESDPKPDSTCCDPEAEPENEVIPLICRWTGCDEEFPHQQAF 452

Human   254 KYHL-KTH---RNDRSFICPAEGCG---KSFYVLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAG 311
            ..|: |.|   |....|.|....|.   |.|....:|.:|||.|:||||..|...||.|.|:...
  Fly   453 VEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLE 517

Human   312 NLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQV--CGKTFSQSGSRNVH 374
            |||.|:|.||||:|:.|:.:||.::|:..|...||...|...||:.||:  |.|.::...|...|
  Fly   518 NLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKH 582

Human   375 MRKHHLQLGAAGSQEQEQTA----EPLMG------------SSLLEE-------ASVPS------ 410
            ::.|.|:  .|..|.:.::|    .|..|            |:|::.       .:|||      
  Fly   583 VKNHALR--NANGQLRRKSAGGASVPPSGPKKAAKTRRHSESALVQRGVGAGVGVAVPSAPGDQR 645

Human   411 ---KNLVS-------------------MNSQP---------------SLGGESLNLPNTNSILGV 438
               .|..|                   ...||               :....|:|....::.:.:
  Fly   646 QHRSNSCSEALLLQQHQQQQQQQQQQQKQHQPENERTTDRSNCGTGVAANNNSMNFNELSNCIVI 710

Human   439 DDEVLAEG--SPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQESLAPLPRLE----CSGAF 497
            .:...:.|  .|.:|::....|....|..:|                ::||.|..|    |||..
  Fly   711 IEHNQSGGPAGPATLATATATTTATATYGNG----------------NMAPAPETEVLSVCSGGG 759

Human   498 SAHCN 502
            |::.|
  Fly   760 SSNSN 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF410NP_001229853.1 zf-C2H2_8 268..351 CDD:292531 35/85 (41%)
C2H2 Zn finger 271..290 CDD:275370 7/21 (33%)
zf-H2C2_2 283..309 CDD:290200 14/25 (56%)
C2H2 Zn finger 298..320 CDD:275368 10/21 (48%)
zf-H2C2_2 312..338 CDD:290200 13/25 (52%)
C2H2 Zn finger 328..350 CDD:275368 7/21 (33%)
zf-H2C2_2 342..367 CDD:290200 9/26 (35%)
C2H2 Zn finger 358..378 CDD:275368 6/21 (29%)
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 14/25 (56%)
C2H2 Zn finger 504..526 CDD:275368 10/21 (48%)
C2H2 Zn finger 534..556 CDD:275368 7/21 (33%)
C2H2 Zn finger 564..586 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.