DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF410 and CG31224

DIOPT Version :9

Sequence 1:NP_001229853.1 Gene:ZNF410 / 57862 HGNCID:20144 Length:516 Species:Homo sapiens
Sequence 2:NP_001287396.1 Gene:CG31224 / 42237 FlyBaseID:FBgn0051224 Length:1784 Species:Drosophila melanogaster


Alignment Length:149 Identity:49/149 - (32%)
Similarity:72/149 - (48%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   233 EKKLKCTVEGCDRTFVWPAHFKYHLKTH--RNDRSFICPAEGCGKSFYVLQRLKVHMRTHNGEKP 295
            |.:..|.:  |.::|....:.|.|...|  |..:.|.|  |.|.|:|......|.|:..|...||
  Fly  1635 EPQYDCAI--CSKSFSTKWNLKIHSWVHANRTAKPFKC--EYCPKAFVRELDFKNHINAHKQIKP 1695

Human   296 FMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQV 360
            :.|...||  :|....|...|||.|.|.|.|.|:.  |.:||..:..|.:|..:|:||:|..|.:
  Fly  1696 YTCEYCGC--KFIRKYNYMRHRREHHGTKKFTCDQ--CDKSFHRHYYLIEHRRMHTGERPFTCTI 1756

Human   361 CGKTFSQSGSRNVHMRKHH 379
            |||:.:...:.|.|::.||
  Fly  1757 CGKSSTTKTNHNKHLKIHH 1775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF410NP_001229853.1 zf-C2H2_8 268..351 CDD:292531 28/82 (34%)
C2H2 Zn finger 271..290 CDD:275370 6/18 (33%)
zf-H2C2_2 283..309 CDD:290200 9/25 (36%)
C2H2 Zn finger 298..320 CDD:275368 8/21 (38%)
zf-H2C2_2 312..338 CDD:290200 11/25 (44%)
C2H2 Zn finger 328..350 CDD:275368 6/21 (29%)
zf-H2C2_2 342..367 CDD:290200 10/24 (42%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
CG31224NP_001287396.1 C2H2 Zn finger 1466..1486 CDD:275368
C2H2 Zn finger 1494..1514 CDD:275368
zf-H2C2_2 1506..1531 CDD:290200
C2H2 Zn finger 1522..1542 CDD:275368
PHA00733 1527..1623 CDD:177301
C2H2 Zn finger 1554..1573 CDD:275370
C2H2 Zn finger 1580..1599 CDD:275368
C2H2 Zn finger 1613..1632 CDD:275368
COG5048 <1637..1780 CDD:227381 48/147 (33%)
C2H2 Zn finger 1640..1660 CDD:275368 5/21 (24%)
C2H2 Zn finger 1670..1690 CDD:275368 7/21 (33%)
C2H2 Zn finger 1698..1718 CDD:275368 8/21 (38%)
zf-H2C2_2 1710..1735 CDD:290200 12/26 (46%)
C2H2 Zn finger 1726..1746 CDD:275368 6/21 (29%)
zf-H2C2_2 1738..1763 CDD:290200 10/24 (42%)
C2H2 Zn finger 1754..1774 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.