| Sequence 1: | NP_001229853.1 | Gene: | ZNF410 / 57862 | HGNCID: | 20144 | Length: | 516 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572446.2 | Gene: | CG2120 / 31737 | FlyBaseID: | FBgn0030005 | Length: | 315 | Species: | Drosophila melanogaster |
| Alignment Length: | 202 | Identity: | 55/202 - (27%) |
|---|---|---|---|
| Similarity: | 85/202 - (42%) | Gaps: | 31/202 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Human 239 TVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCHESGC 303
Human 304 GKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVV-HSG------EKP------ 355
Human 356 -------HQCQVCGKTFSQSGSRNVHMRKHHLQLGAAGSQEQEQTAEPLMGSSLLEEASVPSKNL 413
Human 414 VSMNSQP 420 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ZNF410 | NP_001229853.1 | zf-C2H2_8 | 268..351 | CDD:292531 | 35/83 (42%) |
| C2H2 Zn finger | 271..290 | CDD:275370 | 7/18 (39%) | ||
| zf-H2C2_2 | 283..309 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 298..320 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 312..338 | CDD:290200 | 14/25 (56%) | ||
| C2H2 Zn finger | 328..350 | CDD:275368 | 7/22 (32%) | ||
| zf-H2C2_2 | 342..367 | CDD:290200 | 8/44 (18%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 4/19 (21%) | ||
| CG2120 | NP_572446.2 | C2H2 Zn finger | 101..121 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 113..138 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 129..149 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 142..166 | CDD:290200 | 11/25 (44%) | ||
| COG5048 | 151..>264 | CDD:227381 | 34/121 (28%) | ||
| C2H2 Zn finger | 157..177 | CDD:275368 | 10/21 (48%) | ||
| C2H2 Zn finger | 185..206 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 235..255 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 263..285 | CDD:275368 | 2/21 (10%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||