DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BAK1 and Debcl

DIOPT Version :9

Sequence 1:NP_001179.1 Gene:BAK1 / 578 HGNCID:949 Length:211 Species:Homo sapiens
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:258 Identity:48/258 - (18%)
Similarity:83/258 - (32%) Gaps:77/258 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     2 ASGQG--PGPPR---QECGEPALPSASEEQVAQDTEEVFRSYVFYR------------------- 42
            |.|.|  |.|..   ...|.|...:||...:|..| ....:|..|:                   
  Fly    50 AGGPGSVPNPSNGRSLHAGGPMTRAASTSSLASST-RTMTNYQEYKMDIINQGKCLCGQYIRARL 113

Human    43 -------HQQEQEAEGVAAPADPEMVTLPLQPSSTMGQ------------VGRQL--AIIGDDIN 86
                   .:..|....:..|....:|.......::||:            :.|||  |..|:   
  Fly   114 RRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGE--- 175

Human    87 RRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHG----L 147
             ..||:...||.:|             :|..||.|.|.||:::::.......|:...:.|    |
  Fly   176 -LEDSDMAPMLLNL-------------VAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYL 226

Human   148 TGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAAL-----NLGNGPILNVLVVLGVVLLGQFVV 205
            ...:..:...:.|.:::     |:...|||:...     .:|....|..|.:...:..|.::|
  Fly   227 QCLIDGLAEIIEDDLVY-----WLIDNGGWLGLSRHIRPRVGEFTFLGWLTLFVTISAGAYMV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BAK1NP_001179.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 9/30 (30%)
Bcl-2_like 29..183 CDD:132900 33/202 (16%)
BH3 74..88 5/15 (33%)
BH1 117..136 6/18 (33%)
BH2 169..184 4/19 (21%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 30/171 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.