DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN7 and Ptp61F

DIOPT Version :9

Sequence 1:XP_011508121.1 Gene:PTPN7 / 5778 HGNCID:9659 Length:511 Species:Homo sapiens
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:323 Identity:91/323 - (28%)
Similarity:130/323 - (40%) Gaps:106/323 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   224 HASK--DRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWE 286
            |.::  :||:.:.|...||:.|.|...    ||||||.:: .:..|:.||.||||:.:||..||.
  Fly    58 HTNRGLNRYRDVNPYDHSRIVLKRGSV----DYINANLVQ-LERAERQYILTQGPLVDTVGHFWL 117

Human   287 MVWQEEVSLIVMLTQLREGKE-KCVHYWPTEE--------------------ETYGPFQIRIQDM 330
            |||:::...::||.:|.|.|: ||..|||.|.                    |||..|       
  Fly   118 MVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNF------- 175

Human   331 KECPEYTVR---QLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPI 392
                   ||   :||....::.|.|....::.|||...|.|....|:.:.:|.:|...:...||.
  Fly   176 -------VRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPA 233

Human   393 VVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRLLERRKLEAQEYSWPDPRLQRS 457
            ||||||||||:|.|.........:...||.::..::|:||..|:                     
  Fly   234 VVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRM--------------------- 277

Human   458 GFVPGAEWIKEDQVSTWGITPQHVGGMIQTAEQYQF-----------LHHTLALYAGQLPEEP 509
                                     |:||||:|..|           ||....|.|    |||
  Fly   278 -------------------------GLIQTADQLDFSYQAIIEGIKKLHDPTFLDA----EEP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN7XP_011508121.1 PTPc 201..499 CDD:214550 86/311 (28%)
PTPc 227..499 CDD:238006 85/308 (28%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 84/301 (28%)
PTPc 62..295 CDD:238006 83/297 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.