DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN7 and Ptp4E

DIOPT Version :9

Sequence 1:XP_011508121.1 Gene:PTPN7 / 5778 HGNCID:9659 Length:511 Species:Homo sapiens
Sequence 2:NP_001162669.1 Gene:Ptp4E / 31425 FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster


Alignment Length:353 Identity:92/353 - (26%)
Similarity:146/353 - (41%) Gaps:92/353 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   189 RWALQRQPPSPKQLEEEFLKIPSNFVSP----------------------------EDL------ 219
            |..|.|:.....::::|...:|..:::|                            |:|      
  Fly  1278 RCQLIRRASKLARMQDELAALPEGYITPNRPVHVKDFSEHYRIMSADSDFRFSEEFEELKHVGRD 1342

Human   220 ------DIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMP 278
                  ::|.:..|:|:..|||...||..|......:..|||||||:.|::...: :|.||||:.
  Fly  1343 QACSFANLPCNRPKNRFTNILPYDHSRFKLQPVDDDDGSDYINANYMPGHNSPRE-FIVTQGPLH 1406

Human   279 NTVSDFWEMVWQEEVSLIVMLTQ-LREGKEKCVHYWPTEEET--YGPFQIRIQDMKECPEYTVRQ 340
            :|..:||.|.|:.....|||||: ..:|:|||..|||.:...  ||..::::.......::::.:
  Fly  1407 STREEFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPVDRVAMFYGDIKVQLIIDTHYHDWSISE 1471

Human   341 LTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC 405
            ..:....|.|.::|..|:.|||...||....|:|.|....:...|...  ||:||||||:||:|.
  Fly  1472 FMVSRNCESRIMRHFHFTTWPDFGVPEPPQSLVRFVRAFRDVIGTDMR--PIIVHCSAGVGRSGT 1534

Human   406 FIATRIGCQQLKARGEVDILGIVCQLRLDRLLERRKLEAQEYSWPDPRLQRSGFVPGAEWIKEDQ 470
            |||.....|.:.....|||.|||..:|.:|:.                                 
  Fly  1535 FIALDRILQHIHKSDYVDIFGIVFAMRKERVF--------------------------------- 1566

Human   471 VSTWGITPQHVGGMIQTAEQYQFLHHTL 498
                         |:||.:||..:|..|
  Fly  1567 -------------MVQTEQQYVCIHQCL 1581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN7XP_011508121.1 PTPc 201..499 CDD:214550 89/341 (26%)
PTPc 227..499 CDD:238006 83/275 (30%)
Ptp4ENP_001162669.1 FN3 151..242 CDD:238020
fn3 247..328 CDD:278470
fn3 343..417 CDD:278470
fn3 443..525 CDD:278470
FN3 548..611 CDD:238020
FN3 620..706 CDD:238020
fn3 708..796 CDD:278470
fn3 824..886 CDD:278470
fn3 902..978 CDD:278470
fn3 1013..1092 CDD:278470
UP_III_II 1106..>1248 CDD:297589
PTPc 1329..1582 CDD:214550 86/302 (28%)
PTPc 1355..1582 CDD:238006 83/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.