DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN6 and Lar

DIOPT Version :10

Sequence 1:NP_536859.1 Gene:PTPN6 / 5777 HGNCID:9658 Length:624 Species:Homo sapiens
Sequence 2:NP_001260594.1 Gene:Lar / 35259 FlyBaseID:FBgn0000464 Length:2032 Species:Drosophila melanogaster


Alignment Length:393 Identity:138/393 - (35%)
Similarity:191/393 - (48%) Gaps:69/393 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   232 KKQESEDTAKAGFWEEFESLQK-QEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSN 295
            ::.:|.|..|  |.:|:||::. |:....:..||    .||.||||.|:..:|||||.|...: .
  Fly  1467 ERLKSNDNQK--FSQEYESIEPGQQFTWDNSNLE----HNKSKNRYANVTAYDHSRVQLPAVE-G 1524

Human   296 IPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK 360
            :.|||||||||....     .....|:|:||.|:.|..|||:|.|:..:..|||.||..|:.|.|
  Fly  1525 VVGSDYINANYCDGY-----RKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIK 1584

Human   361 CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSE 425
            |..|||..|.: .||...||.....:...|.:||.|:......|. |||...|:.:|||||||..
  Fly  1585 CDQYWPTRGTE-TYGQIFVTITETQELATYSIRTFQLCRQGFNDR-REIKQLQFTAWPDHGVPDH 1647

Human   426 PGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQM 490
            |...|.||.:.  |..:.|.:||:|||||||:||||..||||.::|.:..:.:   |||...:..
  Fly  1648 PAPFLQFLRRC--RALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKI---IDIYGHVTC 1707

Human   491 VRAQRSGMVQTEAQYKFIYVAI------------AQFIETTKKKL---EVLQSQKGQESEYGNIT 540
            :||||:.|||||.||.||:.||            |:.:.|..:||   |..::..|.|.|:    
  Fly  1708 LRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGETISGMEVEF---- 1768

Human   541 YPPAMKNAHAKASRTSSKSLESSAGTVAASPVRRGGQRGLPVPGPPVLSPDLHQLP------VLA 599
                        .:.|:..::||....|..|..:...|            .:|.||      .|.
  Fly  1769 ------------KKLSNVKMDSSKFVTANLPCNKHKNR------------LVHILPYESSRVYLT 1809

Human   600 PLH 602
            |:|
  Fly  1810 PIH 1812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN6NP_536859.1 SH2_N-SH2_SHP_like 3..101 CDD:198203
SH2_C-SH2_SHP_like 109..215 CDD:198185
PTPc-N6 253..518 CDD:350454 112/277 (40%)
LarNP_001260594.1 I-set 36..129 CDD:400151
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 141..228 CDD:472250
Ig strand B 157..161 CDD:409353
Ig strand C 170..174 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 218..221 CDD:409353
IgI_3_RPTP_IIa_LAR_like 237..319 CDD:409401
Ig strand A 237..239 CDD:409401
Ig strand A' 244..248 CDD:409401
Ig strand B 251..259 CDD:409401
Ig strand C 264..270 CDD:409401
Ig strand C' 272..274 CDD:409401
Ig strand D 277..281 CDD:409401
Ig strand E 286..291 CDD:409401
Ig strand F 298..305 CDD:409401
Ig strand G 309..318 CDD:409401
FN3 322..411 CDD:238020
FN3 <382..747 CDD:442628
FN3 712..810 CDD:238020
FN3 832..898 CDD:214495
FN3 <867..1269 CDD:442628
fn3 914..998 CDD:394996
R-PTPc-LAR-1 1498..1735 CDD:350401 109/253 (43%)
R-PTP-LAR-2 1784..2021 CDD:350402 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.