DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIB3 and HSL1

DIOPT Version :9

Sequence 1:NP_001288130.1 Gene:TRIB3 / 57761 HGNCID:16228 Length:385 Species:Homo sapiens
Sequence 2:NP_012821.2 Gene:HSL1 / 853760 SGDID:S000001584 Length:1518 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:86/322 - (26%)
Similarity:136/322 - (42%) Gaps:58/322 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    83 PDRATAVATAS-------RLGPYVL---LEPEEGGRAYQALHCPTGTEYTCKVYPVQEAL----- 132
            ||...:|||.|       .:||:.|   |.....||...|.:..||.....|:.|.::|.     
Yeast    59 PDSTVSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSN 123

Human   133 ------------------------------AVLEPYA--------RLPPHKHVARPTEVLAGTQL 159
                                          :...||.        :|..|.:|....||......
Yeast   124 NGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSE 188

Human   160 LYAFFTRTH-GDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFADRERK 223
            ||....... |::...:.|:.::||.||...|:|:...:::||...:..|||| ...:..|::.:
Yeast   189 LYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLK-PENLLLDKKNR 252

Human   224 KLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTMLAGHYPF 288
            ::.:.:. ....|..|:..|......|.|..|||:..| .|.|..:||||.|:.||.:|.||.||
Yeast   253 RIKIADF-GMAALELPNKLLKTSCGSPHYASPEIVMGR-PYHGGPSDVWSCGIVLFALLTGHLPF 315

Human   289 QDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQ-DPMPL 349
            .|.....|..|::.|.|.:|:.||:.||.|:..:|..:|.:|:|...||.||.::: |.:|:
Yeast   316 NDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIB3NP_001288130.1 PK_TRB3 101..342 CDD:270926 75/284 (26%)
S_TKc 107..342 CDD:214567 74/278 (27%)
HSL1NP_012821.2 STKc_BRSK1_2 79..369 CDD:270983 78/292 (27%)
AMPKA_C_like 1347..1517 CDD:418410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.