DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRIB3 and trbl

DIOPT Version :9

Sequence 1:NP_001288130.1 Gene:TRIB3 / 57761 HGNCID:16228 Length:385 Species:Homo sapiens
Sequence 2:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster


Alignment Length:288 Identity:104/288 - (36%)
Similarity:145/288 - (50%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   117 TGTEYTCKVYPVQEAL-AVLEPYARLPPHKHVARPTEVLA----------------GTQLLYA-- 162
            ||.::.|::  |.|.| .|...|.:|..|....|.:.:..                .|.:|.|  
  Fly   147 TGEQFLCRI--VNEPLHKVQRAYFQLQQHDEELRRSTIYGHPLIRPVHDIIPLTKDRTYILIAPV 209

Human   163 --------FFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFAD 219
                    ..|..:.::|:.:|...|:.|.||..:|.|:...:..||::|::||||||.||.|.|
  Fly   210 PQERDSTGGVTGVYENLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKRFYFID 274

Human   220 RERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTMLAG 284
            ..|.||..|:||.|.:|.|.||:|.||..||.|..||:|..:.:|.||.||:|||||.|:|||.|
  Fly   275 EARTKLQYESLEGSMILDGEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILYTMLVG 339

Human   285 HYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQDPMPL 349
            .|||.:.....|...||.|...:|..||...|.|:..|||::..||:||:.|.|.||||:.    
  Fly   340 QYPFYEKANCNLITVIRHGNVQIPLTLSKSVRWLLLSLLRKDYTERMTASHIFLTPWLREQ---- 400

Human   350 APTRSHLWEAAQVVPDGLGLDEAREEEG 377
            .|...:|....:|..|   ..:|.|:||
  Fly   401 RPFHMYLPVDVEVAED---WSDAEEDEG 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRIB3NP_001288130.1 PK_TRB3 101..342 CDD:270926 93/251 (37%)
S_TKc 107..342 CDD:214567 93/251 (37%)
trblNP_524672.1 PKc_like 131..397 CDD:328722 93/251 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159489
Domainoid 1 1.000 181 1.000 Domainoid score I3485
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3953
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362510at2759
OrthoFinder 1 1.000 - - FOG0001790
OrthoInspector 1 1.000 - - otm40776
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22961
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1487
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.