DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCUBE2 and Cubn

DIOPT Version :9

Sequence 1:NP_001354906.1 Gene:SCUBE2 / 57758 HGNCID:30425 Length:1028 Species:Homo sapiens
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:1207 Identity:247/1207 - (20%)
Similarity:373/1207 - (30%) Gaps:459/1207 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    45 DVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCE-DIDEC----GNELNGGCVHDCLN 104
            :.:.||.|  .|.....|.||.|.::|.|:..:  ||.:|| |::||    |.:|  ||      
  Fly   154 EANSCASG--PCENGGTCYNTYTGFRCQCRSAF--EGTKCEMDVNECALYEGTDL--GC------ 206

Human   105 IPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIH 169
                                         :|.|.||    |..|:|.|.|:.|:           
  Fly   207 -----------------------------QNGGQCQ----NHFGTYSCLCQPGW----------- 227

Human   170 RSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADG 234
               .|:.|..:...||.        |.|.|                .|.||:  |..|.||.  |
  Fly   228 ---HGMHCTQRKADCSQ--------SSAWE----------------LCGHGS--CVPSADDA--G 261

Human   235 PECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKD 299
            ..|.|.|.:|  |:|.:.:..|| |.|.::|                      ..:..|..:|.:
  Fly   262 YRCICEPGWK--TNGLTPICGED-VDECSDS----------------------AAHKPCSTSCIN 301

Human   300 TSTGVHCS-CPVGFTLQLDGKTCKDIDECQTRNGGCDHF----CKNIVGSFDCG-CKKGFKLLTD 358
            ......|: ||.|.|  .:|.:|:|:|||||.||||...    |.|..||:.|| |..|:  ..|
  Fly   302 LPGSFTCAPCPAGLT--GNGVSCRDLDECQTNNGGCSLSPKVDCINTYGSYHCGECPVGW--TGD 362

Human   359 EKSC----QDVD--ECSLDRTC---------DHSCINHPGTFACACNRGY--TLYGFTHC--GDT 404
            .:.|    ||:|  .....|||         ..||....||.:|.|..|.  |.||...|  |.|
  Fly   363 GRKCERSPQDIDIPAGQTPRTCPAGNNPCYPTASCFLISGTTSCRCPMGMVGTGYGPNGCVNGTT 427

Human   405 NECSIN---NGGCQQVCVNT-VGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVS---LHCG 462
            ..|..|   |||   :|:.. ..:|.|.|..|::               |....|:.|   .|..
  Fly   428 TNCKENPCLNGG---ICLFAGPSNYTCLCPIGFR---------------PPICEPQPSPCDQHPC 474

Human   463 KSGG-------GDGCFLRCHSGIH------LSSGLQGAYSVTCG------SSSPLRNKQQ----- 503
            |:||       ||....:|..|..      ..|...|..|...|      ..:...:..|     
  Fly   475 KNGGRCRPTTSGDLFVCQCLPGYRGRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVI 539

Human   504 KSNDSAFGDVTTIRTSVT---------FKLNEGKCSLKNAELFPEGLRPALP------------- 546
            ::|:|...:||.....|.         .::|:|:.:.  |::........||             
  Fly   540 RTNESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAA--AQIIGRYCGNHLPHGGNIVSSGNQLY 602

Human   547 ----EKHSSVKESFRYVNLTCSS-----GKQV----------PGAPGR-------------PSTP 579
                ..:|:.||.|   :||.:|     |.::          ||:||.             |:| 
  Fly   603 LWFRSDNSTAKEGF---DLTWNSMEPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTT- 663

Human   580 KEMFITVEFELETNQKEVTASCDLSCIVKR---TEKRLRKAIRT-----LRKAVHREQFHLQLSG 636
            |.:.:|. |.|:..|.   |:|:...::.:   :.:.|.|...|     |....|..:.|.....
  Fly   664 KRIKLTF-FSLQLEQH---ANCNFDYVLIKDSISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDA 724

Human   637 MNLDVAKKPPRTSERQAESCG------------VGQGHAENQCVSCRAGTYYDGARERCI----- 684
            ...|...:...:.|.:...||            ....:.|...|||....:.....:..|     
  Fly   725 EGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARL 789

Human   685 ------------------------LCPNG-------TFQNEEGQMTCEPCPRPGN---------- 708
                                    :|.:.       ||.:|..::..:...|.|:          
  Fly   790 ELDPLDCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYARAGSFQLNYRMACD 854

Human   709 ------SGALKTPEAWNMSECGGLC---------------------QPGEYSADGFAPCQLCAL- 745
                  .|.:.:|...|::....:|                     ..||...|....|....| 
  Fly   855 YKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLR 919

Human   746 --------------GTFQPEAG------------RTSCFPCGGGLATKHQGATSFQDCETRVQCS 784
                          |..|||..            .|.....|.|...:::...:..|     :|.
  Fly   920 INDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGND-----KCG 979

Human   785 PGHFYNTTTHRCIRCPV--GTYQPE---------------------FGKNNCVSC---------- 816
            ..|   |.:...||.||  .:|..|                     |...|.|.|          
  Fly   980 GVH---TRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDS 1041

Human   817 -----------P-----GNTT-------------------TDFDGSTNITQC--KNRRCGGELGD 844
                       |     ||:.                   ::.||..::|..  ...:|||.:..
  Fly  1042 LGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHA 1106

Human   845 FTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDC-GDYLVMRKTSSSNSVTT 908
            .:|.:.||.||.||.|..:|.|.:.......:.|.|....|....:| .|||.:|....::|...
  Fly  1107 SSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLI 1171

Human   909 YETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQV 945
            ...|.. :.|......|.::.:...::...:.|||::
  Fly  1172 GRFCGR-DIPARIPGFSHEMRLILHTDSAINGRGFRL 1207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCUBE2NP_001354906.1 None
CubnNP_727348.2 EGF_CA 156..190 CDD:238011 12/37 (32%)
EGF_CA 192..233 CDD:238011 18/95 (19%)
EGF_CA 282..322 CDD:214542 12/64 (19%)
EGF_3 328..366 CDD:289699 16/39 (41%)
EGF 430..457 CDD:278437 9/29 (31%)
EGF_CA 469..503 CDD:238011 8/33 (24%)
CUB 509..622 CDD:238001 20/117 (17%)
CUB 627..737 CDD:238001 21/114 (18%)
CUB 744..849 CDD:294042 13/104 (13%)
CUB 853..970 CDD:238001 16/116 (14%)
CUB 978..1094 CDD:238001 19/118 (16%)
CUB 1100..1211 CDD:238001 28/109 (26%)
CUB 1216..1330 CDD:238001
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.