| Sequence 1: | NP_001380868.1 | Gene: | ANKRD36B / 57730 | HGNCID: | 29333 | Length: | 1353 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001356957.1 | Gene: | Patsas / 34634 | FlyBaseID: | FBgn0029137 | Length: | 613 | Species: | Drosophila melanogaster |
| Alignment Length: | 195 | Identity: | 55/195 - (28%) |
|---|---|---|---|
| Similarity: | 87/195 - (44%) | Gaps: | 27/195 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Human 25 HRAVLRGNLEKLKYLLLTYYDANKRDRKERTA--------------LHLACATGQPEMVHLLVSR 75
Human 76 RCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDTSMIEKLLS 140
Human 141 HGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKK-KANVNAIDYLGRSALILAVTLGEKDIVILL 204
Human 205 204 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ANKRD36B | NP_001380868.1 | ANKYR | 17..209 | CDD:223738 | 55/195 (28%) |
| ANK 1 | 19..48 | 6/22 (27%) | |||
| Ank_2 | 24..116 | CDD:403870 | 29/104 (28%) | ||
| ANK repeat | 24..50 | CDD:293786 | 6/24 (25%) | ||
| ANK 2 | 52..81 | 10/42 (24%) | |||
| ANK repeat | 54..83 | CDD:293786 | 10/42 (24%) | ||
| ANK repeat | 85..116 | CDD:293786 | 11/30 (37%) | ||
| ANK 3 | 85..114 | 10/28 (36%) | |||
| ANK 4 | 118..147 | 9/28 (32%) | |||
| ANK repeat | 118..142 | CDD:293786 | 8/23 (35%) | ||
| ANK repeat | 151..182 | CDD:293786 | 7/31 (23%) | ||
| ANK 5 | 151..180 | 7/29 (24%) | |||
| ANK repeat | 184..215 | CDD:293786 | 7/21 (33%) | ||
| ANK 6 | 184..213 | 7/21 (33%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 249..307 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 349..607 | ||||
| CCDC158 | 712..>1342 | CDD:318193 | |||
| CCDC144C | 949..1240 | CDD:405585 | |||
| Patsas | NP_001356957.1 | ANKYR | 113..306 | CDD:223738 | 46/163 (28%) |
| ANK repeat | 148..181 | CDD:293786 | 10/38 (26%) | ||
| ANK repeat | 187..214 | CDD:293786 | 7/26 (27%) | ||
| ANK repeat | 216..247 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 249..280 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 282..314 | CDD:293786 | 7/31 (23%) | ||
| Ank_4 | 283..336 | CDD:316185 | 13/52 (25%) | ||
| DHHC | 455..567 | CDD:334580 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||