DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN2 and PTP-ER

DIOPT Version :9

Sequence 1:XP_005258181.1 Gene:PTPN2 / 5771 HGNCID:9650 Length:438 Species:Homo sapiens
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:498 Identity:98/498 - (19%)
Similarity:161/498 - (32%) Gaps:209/498 - (41%)


- Green bases have known domain annotations that are detailed below.


Human     3 TTIER------EFEELDTQRRWQPLYLEIRNESHDYPHRVAKFP---ENRNRNRYRDVSPYDHSR 58
            |.:.|      |.:|.:.:|    ::.::..|..|.|....:.|   .::.:|||:.:.|.::||
  Fly   871 TVVSRMAQPIPELKENEQKR----IFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSR 931

Human    59 VKLQNAEND---------------------YINASLV-DIEEAQRSYILTQGPLPNTCCHFWLMV 101
            |.|::..::                     ||||:.: ..:...:.|:.||||||||...||||:
  Fly   932 VLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMI 996

Human   102 W---------------------------QQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKET 139
            :                           ||..:.:|||....|....|||.|:|.:..|:.....
  Fly   997 YQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAA 1061

Human   140 GFSVKLLSEDVKSYYTVHL----------LQLENINY--------IENLWITL------------ 174
            ...|..||...:.|:..:|          ...:.|:|        :|::.:||            
  Fly  1062 KCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQG 1126

Human   175 --YL---------------KLLMLDVKRSLKSGETRT----ISHFHYTTWPDFGVPESPASFLNF 218
              :|               ||::|...|..:|.....    ..|:.|..|||...|....:.|:.
  Fly  1127 SFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDT 1191

Human   219 LFKVRESGSLNPD-------------HGPA------------------VIHCSAGIGRSGTFSLV 252
            ...|...|....:             |..|                  ||||||||||:|.|:.:
  Fly  1192 CLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAI 1256

Human   253 ----------------------------------------DTCLVL------------------- 258
                                                    .||..:                   
  Fly  1257 LNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPP 1321

Human   259 ----MEKGDDI--NIKQVLLNMRKYRMGLIQTPDQLRFSYMAI 295
                :.|..||  ::..::.|:|..|.|::|..:|....:.||
  Fly  1322 SFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAI 1364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN2XP_005258181.1 PTP_DSP_cys 19..295 CDD:391942 91/474 (19%)
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 87/447 (19%)
PTPc 917..1364 CDD:238006 87/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.