DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN1 and CG42327

DIOPT Version :9

Sequence 1:NP_002818.1 Gene:PTPN1 / 5770 HGNCID:9642 Length:435 Species:Homo sapiens
Sequence 2:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster


Alignment Length:315 Identity:89/315 - (28%)
Similarity:146/315 - (46%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    22 DIRHEASDFPCRVAKL----PKNKNRNRYRDVSPFDHSRIKLHQEDND----YINASLIK-MEEA 77
            |:..|..|.|..:|:.    |..:::|||.:|.|...:|:.|.::.:|    ||||:.:: ..:|
  Fly  1110 DVFEEFRDVPQIIARADEVPPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVRGPRDA 1174

Human    78 QRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKL 142
            ...||..|.||.:|...||.|:|||:||.::....:.|.|..:||:|.|.....:......:.::
  Fly  1175 PNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEYLPPSATLDNHSSYGDYQV 1239

Human   143 TLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVR-------- 199
            ||...::|..|.:..|.|:.:..:|:||:.|:.| .||:.|||...|..:..|.:.|        
  Fly  1240 TLKHREVKDRYAISTLVLKRVDGEESRELTHYWY-KWPEAGVPAEEAPIIAMLLEARSSLKSYSL 1303

Human   200 ------------------------ESGSLS---------------PEHGPVVVHCSAGIGRSGTF 225
                                    |:||.|               .:.||:.||||.|.||:||.
  Fly  1304 EQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTI 1368

Human   226 CLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSY-LAVIEGAK 279
            ..:|..:..::..|  .||||.:::..:|:.|...:||.:|..|.| :|.:..||
  Fly  1369 IASDMAIRSLETPK--RSVDIPQLVYYVRRGRASAVQTKEQYEFIYKVASMYAAK 1421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN1NP_002818.1 PTPc 3..276 CDD:214550 87/310 (28%)
Substrate binding. /evidence=ECO:0000250 215..221 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..359
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..398
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 80/283 (28%)
Y_phosphatase 1134..1415 CDD:278528 80/283 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.