Sequence 1: | NP_001245348.1 | Gene: | LRRC4C / 57689 | HGNCID: | 29317 | Length: | 640 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012529.3 | Gene: | CYR1 / 853452 | SGDID: | S000003542 | Length: | 2026 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 313 | Identity: | 79/313 - (25%) |
---|---|---|---|
Similarity: | 140/313 - (44%) | Gaps: | 48/313 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 19 NRALFDPLLVVLLALQLLVVAGL-VRAQTCPSVCSCSNQFSKVICVRKNLREVPDGIS--TNTRL 80
Human 81 LNLHENQIQIIKVNSFKHLRHLEILQLSRN---HIRTIEIGAFNGLANLNTLELFDNRLTTIPNG 142
Human 143 AFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMC 207
Human 208 NLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGL--MHLQKLWMIQSQIQVIERNAFDNLQSLV 270
Human 271 EINLAHNNLTLLPHDL----------------------FTPLHHLERIHLHHN 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LRRC4C | NP_001245348.1 | LRRNT | 47..80 | CDD:214470 | 8/34 (24%) |
PPP1R42 | 65..235 | CDD:411060 | 48/174 (28%) | ||
LRR 1 | 77..98 | 6/20 (30%) | |||
leucine-rich repeat | 78..101 | CDD:275380 | 6/22 (27%) | ||
LRR 2 | 101..122 | 6/23 (26%) | |||
leucine-rich repeat | 102..125 | CDD:275380 | 7/25 (28%) | ||
LRR 3 | 125..146 | 5/20 (25%) | |||
leucine-rich repeat | 126..149 | CDD:275380 | 6/22 (27%) | ||
LRR 4 | 149..170 | 5/20 (25%) | |||
leucine-rich repeat | 150..173 | CDD:275380 | 4/22 (18%) | ||
LRR 5 | 173..195 | 8/21 (38%) | |||
leucine-rich repeat | 174..198 | CDD:275380 | 8/23 (35%) | ||
LRR 6 | 198..219 | 5/20 (25%) | |||
leucine-rich repeat | 199..220 | CDD:275380 | 4/20 (20%) | ||
LRR_8 | 220..279 | CDD:404697 | 14/60 (23%) | ||
LRR 7 | 220..241 | 7/20 (35%) | |||
leucine-rich repeat | 221..244 | CDD:275380 | 6/24 (25%) | ||
LRR 8 | 244..265 | 3/20 (15%) | |||
leucine-rich repeat | 245..268 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 267..>301 | CDD:404697 | 12/55 (22%) | ||
LRR 9 | 268..289 | 8/42 (19%) | |||
leucine-rich repeat | 269..290 | CDD:275380 | 8/42 (19%) | ||
LRRCT | 301..>339 | CDD:214507 | 1/1 (100%) | ||
IG | 360..443 | CDD:214652 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 463..483 | ||||
CYR1 | NP_012529.3 | Ad_cyc_g-alpha | 368..418 | CDD:369912 | |
RA_PHLPP_like | 678..776 | CDD:340473 | |||
PLN00113 | 792..>1273 | CDD:215061 | 79/313 (25%) | ||
leucine-rich repeat | 796..817 | CDD:275380 | |||
leucine-rich repeat | 818..839 | CDD:275380 | 4/12 (33%) | ||
leucine-rich repeat | 840..864 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 865..887 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 888..910 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 911..933 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 934..956 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 957..978 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 979..1018 | CDD:275380 | 14/45 (31%) | ||
leucine-rich repeat | 1019..1041 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 1042..1065 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 1066..1088 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 1089..1111 | CDD:275380 | 1/21 (5%) | ||
leucine-rich repeat | 1167..1187 | CDD:275380 | |||
leucine-rich repeat | 1191..1211 | CDD:275380 | |||
leucine-rich repeat | 1236..1258 | CDD:275380 | |||
leucine-rich repeat | 1259..1287 | CDD:275380 | |||
PP2C | 1374..1617 | CDD:395385 | |||
CYCc | 1613..1825 | CDD:214485 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |