DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRC4C and lron-8

DIOPT Version :9

Sequence 1:NP_001245348.1 Gene:LRRC4C / 57689 HGNCID:29317 Length:640 Species:Homo sapiens
Sequence 2:NP_491676.2 Gene:lron-8 / 181983 WormBaseID:WBGene00020693 Length:341 Species:Caenorhabditis elegans


Alignment Length:413 Identity:90/413 - (21%)
Similarity:171/413 - (41%) Gaps:101/413 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    22 LFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKN----LREVPDGISTNTRLLN 82
            :.:.:|||       |:.|:|.|.   :..||.....::.|..||    |::..|.:..:|  ||
 Worm     1 MIEKVLVV-------VIIGVVGAY---AQGSCRTDQHEMTCRGKNSLHDLKKDQDYLEVDT--LN 53

Human    83 LHENQIQIIK--VNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFV 145
            :|:.::.:..  |....:|.||.:|..:.|.|..|....|:.:.|:..|.|..|:::......|.
 Worm    54 VHQAKLDLTDDLVPDGINLSHLTLLNATDNQITRIGRRGFDKIRNMQFLYLSINQISHSQPDPFQ 118

Human   146 YLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLR 210
            .|.|||.|.:.:                  .|| |.::..|.:....|...::            
 Worm   119 ALEKLKRLEMND------------------ALD-GNMEEKSDMLRNFFHSKNS------------ 152

Human   211 EIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIE--RNAFDNLQSLVEIN 273
                   .:.|.:::|:.|.:..|.|.:|.|:..||:|.:..::|...:  |.....|::|:   
 Worm   153 -------FVHLAQIELNKNKIEGIYPKTFCGIQGLQRLELSNNRIPSFDFARTCLKELKALM--- 207

Human   274 LAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNC---------DILWLSWWIKDMAPSNTACCAR 329
            ||.|.:..:|.|::..|..|..:.:.:||.:|:|         |:::|:       .::|    :
 Worm   208 LAGNLIQKIPADIWDFLPSLSSLDISNNPIDCDCATIRLLSGDDVVFLN-------QADT----K 261

Human   330 CNTPPNLKGRYIGELDQNYF-TCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTV 393
            |.:||.|:|:.|.||.::|. |...|                   :.:||.....|.::...|.:
 Worm   262 CASPPELEGKRIFELSRDYCKTTRNP-------------------RGKASFFQFLVLFVIAVGIL 307

Human   394 MTHGAYKVRIAVLSDGTLNFTNV 416
            ..:..|:.|...:|...:.:||:
 Worm   308 WLYKKYRERTRHMSSVPVGYTNL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRC4CNP_001245348.1 LRRNT 47..80 CDD:214470 8/36 (22%)
PPP1R42 65..235 CDD:411060 35/175 (20%)
LRR 1 77..98 5/22 (23%)
leucine-rich repeat 78..101 CDD:275380 6/24 (25%)
LRR 2 101..122 7/20 (35%)
leucine-rich repeat 102..125 CDD:275380 6/22 (27%)
LRR 3 125..146 5/20 (25%)
leucine-rich repeat 126..149 CDD:275380 5/22 (23%)
LRR 4 149..170 4/20 (20%)
leucine-rich repeat 150..173 CDD:275380 3/22 (14%)
LRR 5 173..195 5/21 (24%)
leucine-rich repeat 174..198 CDD:275380 5/23 (22%)
LRR 6 198..219 0/20 (0%)
leucine-rich repeat 199..220 CDD:275380 0/20 (0%)
LRR_8 220..279 CDD:404697 17/60 (28%)
LRR 7 220..241 6/20 (30%)
leucine-rich repeat 221..244 CDD:275380 7/22 (32%)
LRR 8 244..265 5/22 (23%)
leucine-rich repeat 245..268 CDD:275380 6/24 (25%)
LRR_8 267..>301 CDD:404697 8/33 (24%)
LRR 9 268..289 6/20 (30%)
leucine-rich repeat 269..290 CDD:275380 6/20 (30%)
LRRCT 301..>339 CDD:214507 11/46 (24%)
IG 360..443 CDD:214652 9/57 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..483
lron-8NP_491676.2 LRR <71..>237 CDD:227223 45/206 (22%)
leucine-rich repeat 75..98 CDD:275380 6/22 (27%)
leucine-rich repeat 99..122 CDD:275380 5/22 (23%)
leucine-rich repeat 123..158 CDD:275380 9/72 (13%)
leucine-rich repeat 159..179 CDD:275380 6/19 (32%)
leucine-rich repeat 180..202 CDD:275380 5/21 (24%)
leucine-rich repeat 203..226 CDD:275380 8/25 (32%)
LRRCT 235..282 CDD:214507 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I4325
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.