DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRN1 and CG5096

DIOPT Version :10

Sequence 1:NP_065924.3 Gene:LRRN1 / 57633 HGNCID:20980 Length:716 Species:Homo sapiens
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:125 Identity:30/125 - (24%)
Similarity:50/125 - (40%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    76 PQLLADDDTRLLQLETQGNQSCYNYLYRMKALDAIRASE-IPFHAEGRHPCSLMGKNFR------ 133
            ||.:......|..::|.|...|..::..|...|...|.| :|...    |..|:..:||      
  Fly   226 PQAMLAQIWALADMDTDGRLGCEEFVLAMYLCDMAAAGEKVPTTL----PPELVPPSFRKATSRH 286

Human   134 SYLLDLRNTSTPFKG--VGKAL-IDTL----LDGYETARYGTGVFGQSEYLRYQEALSEL 186
            ..::..|:.|...:|  |..|: :|.|    ...:|..|......||:|..|.::||.::
  Fly   287 GSVVGSRHGSVSSQGAPVHAAVELDPLSGLPQSSFEDKRKENFDKGQAELERRRKALMDI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRN1NP_065924.3 LRRNT 32..75 CDD:214470
leucine-rich repeat 54..73 CDD:275380
LRR 1 73..95 5/18 (28%)
leucine-rich repeat 74..96 CDD:275380 5/19 (26%)
LRR <89..355 CDD:443914 27/112 (24%)
LRR 2 96..117 5/21 (24%)
leucine-rich repeat 97..120 CDD:275380 6/23 (26%)
LRR 3 120..141 4/26 (15%)
leucine-rich repeat 121..144 CDD:275380 5/28 (18%)
LRR 4 144..165 6/27 (22%)
leucine-rich repeat 145..168 CDD:275380 7/29 (24%)
LRR 5 168..189 6/19 (32%)
leucine-rich repeat 169..192 CDD:275380 6/18 (33%)
LRR 6 192..213
leucine-rich repeat 193..216 CDD:275380
LRR 7 216..237
leucine-rich repeat 217..240 CDD:275380
LRR 8 240..261
leucine-rich repeat 241..264 CDD:275380
LRR 9 264..285
leucine-rich repeat 265..288 CDD:275380
leucine-rich repeat 289..313 CDD:275380
LRR 10 313..335
leucine-rich repeat 314..335 CDD:275380
LRR 11 338..359
leucine-rich repeat 339..362 CDD:275378
leucine-rich repeat 363..375 CDD:275378
LRRCT 371..419 CDD:214507
I-set 429..516 CDD:400151
Ig strand B 443..447 CDD:409562
Ig strand C 456..460 CDD:409562
Ig strand E 483..486 CDD:409562
Ig strand F 496..501 CDD:409562
Ig strand G 509..512 CDD:409562
FN3 531..600 CDD:214495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..716
CG5096NP_723576.1 LRR 54..>322 CDD:443914 22/99 (22%)
leucine-rich repeat 85..104 CDD:275380
leucine-rich repeat 105..128 CDD:275380
leucine-rich repeat 129..163 CDD:275380
leucine-rich repeat 164..187 CDD:275380
leucine-rich repeat 188..214 CDD:275380
leucine-rich repeat 215..238 CDD:275380 3/11 (27%)
leucine-rich repeat 239..261 CDD:275380 5/21 (24%)
leucine-rich repeat 262..286 CDD:275380 7/27 (26%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 0/1 (0%)
leucine-rich repeat 370..388 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.