DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WDFY1 and Gga

DIOPT Version :10

Sequence 1:NP_065881.1 Gene:WDFY1 / 57590 HGNCID:20451 Length:410 Species:Homo sapiens
Sequence 2:NP_572571.1 Gene:Gga / 31902 FlyBaseID:FBgn0030141 Length:660 Species:Drosophila melanogaster


Alignment Length:85 Identity:21/85 - (24%)
Similarity:37/85 - (43%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   221 NSIIMWDIGGRKGRTLLLQGHHDKVQSLCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQWLES- 284
            |.::.:.:.....|..||..|.   ..||.:|.|.||::...|      ..|.:.::..:.|.. 
  Fly   182 NLLLQYRMAQEARRNDLLAQHR---LVLCEVQETMQLLNQMLD------TYDPANQDVSETLHEL 237

Human   285 -DSCQKCEQPFFWNIKQMWD 303
             .||:| .:|.|.::.|:.|
  Fly   238 YKSCKK-HKPIFQHLPQLLD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WDFY1NP_065881.1 WD40 16..272 CDD:475233 12/50 (24%)
WD 1 22..61
WD40 repeat 28..67 CDD:293791
WD 2 66..105
WD40 repeat 71..111 CDD:293791
WD 3 112..150
WD40 repeat 117..154 CDD:293791
WD 4 153..192
WD40 repeat 159..197 CDD:293791
WD 5 197..236 2/14 (14%)
WD40 repeat 202..239 CDD:293791 3/17 (18%)
WD 6 240..279 9/38 (24%)
WD40 repeat 246..314 CDD:293791 16/60 (27%)
FYVE_WDFY1 279..354 CDD:277295 8/27 (30%)
WD40 repeat 321..363 CDD:293791
WD 7 364..403
GgaNP_572571.1 VHS_GGA_metazoan 8..144 CDD:340769
GAT_GGA_meta 201..283 CDD:410582 17/66 (26%)
Alpha_adaptinC2 543..644 CDD:197886
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.