DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UNC79 and LOC101884319

DIOPT Version :9

Sequence 1:XP_011535320.1 Gene:UNC79 / 57578 HGNCID:19966 Length:2752 Species:Homo sapiens
Sequence 2:XP_021323190.1 Gene:LOC101884319 / 101884319 -ID:- Length:268 Species:Danio rerio


Alignment Length:264 Identity:208/264 - (78%)
Similarity:227/264 - (85%) Gaps:9/264 - (3%)


- Green bases have known domain annotations that are detailed below.


Human  2452 MHTLTKLKSHMKTCSQPLHEDTFGGHLKVGLAQIAAMDISRGNHRDNKAVIRYLPWLYHPPSAMQ 2516
            ||||||||||||.|.||||||||||:|||||||:|||:||:||||||||||||||||||||||||
Zfish     1 MHTLTKLKSHMKACCQPLHEDTFGGNLKVGLAQVAAMEISKGNHRDNKAVIRYLPWLYHPPSAMQ 65

Human  2517 QGPKEFIECVSHIRLLSWLLLGSLTHNAVCPNASSPCLPIPLDAGSHVADHLIVILIGFPEQSKT 2581
            ||||||||||||||.|||||||||||.|: ...||.|:|||||||||:|||||||||||||||||
Zfish    66 QGPKEFIECVSHIRQLSWLLLGSLTHTAL-QQGSSCCMPIPLDAGSHIADHLIVILIGFPEQSKT 129

Human  2582 SVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQN----EFSFTAILTALEFWSRVTPSILQLMA 2642
            ||||||||||||:|||||||||||::.|.:.||||    |....|:||.||||||||||||||||
Zfish   130 SVLHMCSLFHAFMFAQLWTVYCEQASTAPSSQNQNQNQSELCSGALLTGLEFWSRVTPSILQLMA 194

Human  2643 HNKVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSN----IKHLSAGLQLRLQAIQNHV 2703
            ||:|||||||||||||||||||||||||||||||||||||||    :.|.:|...|....:::|.
Zfish   195 HNRVMVEMVCLHVISLMEALQECNSTIFVKLIPMWLPMIQSNLNVSVDHSAAPALLHSHMLKHHS 259

Human  2704 NHHS 2707
            ..|:
Zfish   260 TPHA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UNC79XP_011535320.1 UNC-79 158..690 CDD:291442
LOC101884319XP_021323190.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D4378at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.