DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STAMBPL1 and eIF3f1

DIOPT Version :10

Sequence 1:NP_065850.1 Gene:STAMBPL1 / 57559 HGNCID:24105 Length:436 Species:Homo sapiens
Sequence 2:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster


Alignment Length:253 Identity:51/253 - (20%)
Similarity:78/253 - (30%) Gaps:92/253 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   113 RSAASRRRDTRMLVTTHQDNGTQQGHPGRAQEAVEDGLEKERK---------------------- 155
            |....||.||..|:.......|...:.|:..:.:...|.|.|.                      
  Fly    25 RDVFQRRCDTNPLIGMPAKVSTVDKYQGQQNDFIILSLVKTRNIGHIRDVRRLVVALSRARLGLY 89

Human   156 NQGRHQPGLDPL----------KHPRDTATL----LDRLTEWRKRCQQWETAWRSYRGPEESKIM 206
            ..||.:..:|.|          |:||....|    ...:.:|.:|.:..|        |.|.:  
  Fly    90 VLGRSKVFMDCLELTPAMRIFAKYPRKLVILPFEAHPTIRKWNERSKDGE--------PMEIQ-- 144

Human   207 CKTKTDSQSETYLSRLYQMYFTSLANMEFSRRLLERDGRFAEMDAQHRARSLLDYMVPRGHTQAD 271
                 |:...|:.  :::.|.::|..|        ||.....|:....::.||:  .|...||.|
  Fly   145 -----DTLHMTHF--VHEFYMSNLPAM--------RDAYEQAMNEYMESQRLLN--PPIDETQMD 192

Human   272 VPP------REPGE-----------------EDSPGPGQQPRAGPALRFLKCQSPGSP 306
            |..      ||..|                 ||.....|:|.|..|      .:||:|
  Fly   193 VETEHEKKHREAMERKKKQEMDDKKEADIHFEDMDHEMQEPAATAA------PAPGAP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STAMBPL1NP_065850.1 USP8_dimer 28..132 CDD:462647 6/18 (33%)
GBP_C <120..198 CDD:293879 19/113 (17%)
MPN_AMSH_like 266..436 CDD:163697 16/64 (25%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 347..360
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 51/253 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.