DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAOK1 and MCK1

DIOPT Version :9

Sequence 1:NP_065842.1 Gene:TAOK1 / 57551 HGNCID:29259 Length:1001 Species:Homo sapiens
Sequence 2:NP_014092.1 Gene:MCK1 / 855409 SGDID:S000005251 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:82/322 - (25%)
Similarity:132/322 - (40%) Gaps:97/322 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    27 LFTDLREIGHGSFGAV---YFARDVRTNEV--VAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHP 86
            |..:.|:||.|:||.|   |..:| :.|.:  .||||:....:..:       :|::.|:...||
Yeast    34 LVKEYRKIGRGAFGTVVQAYLTQD-KKNWLGPFAIKKVPAHTEYKS-------RELQILRIADHP 90

Human    87 NSIEYKGCYLREHTA--------WLVMEYCLGSASDLLEVHK-------KPLQEVEIAAITHGAL 136
            |.::.:  |...|.:        .|.|| ||..... :|:::       .||:.:.:  .|:...
Yeast    91 NIVKLQ--YFFTHLSPQDNKVYQHLAME-CLPETLQ-IEINRYVTNKLEMPLKHIRL--YTYQIA 149

Human   137 QGLAYLHSHTMIHRDIKAGNILL-TEPGQVKLADFGSASMA---SPANSFVGTPYWMAPEVILAM 197
            :|:.|||...:.|||||..|:|: .|.|.:|:.|||||...   .|:.|::.:.::.|||:|:..
Yeast   150 RGMLYLHGLGVCHRDIKPSNVLVDPETGVLKICDFGSAKKLEHNQPSISYICSRFYRAPELIIGC 214

Human   198 DEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPTLQSNEWSD---------- 252
            .  ||..::|:|.||  |:           |..|.....|.|.:.|.||..|.:.          
Yeast   215 T--QYTTQIDIWGLG--CV-----------MGEMLIGKAIFQGQEPLLQLREIAKLLGPPDKRFI 264

Human   253 YFRN------------FVDSCLQKI----------------------PQDRPTSEELLKHIF 280
            :|.|            |..|..|:.                      ||.|.:...:|.|.|
Yeast   265 FFSNPAYDGPLFSKPLFSGSSQQRFEKYFGHSGPDGIDLLMKILVYEPQQRLSPRRILAHQF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAOK1NP_065842.1 STKc_TAO1 2..318 CDD:270805 82/322 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..433
SbcC <442..>877 CDD:223496
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 567..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1001
MCK1NP_014092.1 STKc_GSK3 39..330 CDD:271039 81/317 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.