DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and CG34353

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:651 Identity:148/651 - (22%)
Similarity:230/651 - (35%) Gaps:225/651 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     5 LGLAVLSL----VISQGADGRGKPEVVSVVGRA-------GESVVLGCDLLPPAGRPPLHVIEWL 58
            |.:||:||    |.:|....:.:|..:|   |:       ||::||.|::    .....:|:.|.
  Fly    63 LAIAVVSLHFESVSAQSMMTKNEPMFIS---RSETFKFITGETIVLPCEV----ANTDTYVVAWK 120

Human    59 RFGFLLPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA 123
            | |..:   :..|  |.::.||  .||||..|.:|||......|.|.|.|::..:|         
  Fly   121 R-GIAI---LTAG--SVKVTPD--PRVRLVNGFNLQIRDALPTDAGDYICQIATMD--------- 168

Human   124 NGSWVHLTVNSPPQFQET-----PPAV--------LEVQELEPVTLRCVARGSPLPHVTWKLRGK 175
                       |.:...|     ||.:        |:|::...|.:.|.|.|:|:|:|||..:..
  Fly   169 -----------PREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN 222

Human   176 DLGQGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGS-ATHATQLLVLGPPVIVVPPKNSTVN 239
            .|  ..|:.::.:..|.|..|:|...|||.|.|::..|. |:....|.||..|.|.|........
  Fly   223 IL--PNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSG 285

Human   240 ASQDVSLAC--HAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGS---LRLLATQPDDAGCY 299
            ...:.:|.|  |.|..|..:   ||:|.:.:....|.....|    ||   |.:....|.|.|.|
  Fly   286 EGHEATLVCIVHGETQPEVI---WFKDTMQLDTTERHIMETR----GSRHTLIIRKVHPQDFGNY 343

Human   300 TCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKAL 364
            :||..|.|                                                  .|..|.|
  Fly   344 SCVAENQL--------------------------------------------------GKARKTL 358

Human   365 QLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYN-SLGTAGPSPVTRVLLKAPPAFIERPKEEY 428
            ||...|.          :|:.|...:.:|. ..|| |......||:                |||
  Fly   359 QLSGKPN----------VAVFNSPPISQYK-DRYNISWAVDSHSPI----------------EEY 396

Human   429 FQEVGRELLIPCSAQGDPPPVVSWTKVGRG--LQGQAQVDSNSSLILRPLTKEAHGHWECSASNA 491
                                .:|:.|:.:|  :.|.| :||:||                  |::
  Fly   397 --------------------KLSFRKLPQGHEVVGNA-IDSSSS------------------SSS 422

Human   492 VARVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHD 556
            ::  ::|:.:|..|...|.:          |:|:....|..|      |..|:.........|:|
  Fly   423 MS--SSSSQMYGSGLHAHRI----------GSNMGGLSGLSG------SGSYSGYGNVIHWGHND 469

Human   557 WVSLAVP-VGAAH-------LLVPGLQPHTQYQFSVLAQNKLG------SGPFSEIVLSAPEGLP 607
            |.::.:| |..:|       .:|.||.|...|:.:|.::|:.|      |..||......|..|.
  Fly   470 WRNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSNDGPVDLS 534

Human   608 T 608
            |
  Fly   535 T 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 29/114 (25%)
IG_like 28..110 CDD:214653 27/88 (31%)
I-set 136..223 CDD:254352 28/100 (28%)
Ig 154..220 CDD:143165 22/66 (33%)
Ig_3 226..305 CDD:290638 22/83 (27%)
IG_like 233..319 CDD:214653 21/90 (23%)
Ig 341..404 CDD:299845 12/63 (19%)
IG_like 431..503 CDD:214653 11/73 (15%)
Ig 436..500 CDD:143165 11/65 (17%)
fn3 511..596 CDD:278470 21/98 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626 2/3 (67%)
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 28/111 (25%)
Ig 103..177 CDD:143165 26/105 (25%)
IG_like 191..269 CDD:214653 25/79 (32%)
IGc2 198..258 CDD:197706 20/61 (33%)
I-set 273..360 CDD:254352 27/143 (19%)
Ig 290..359 CDD:143165 23/125 (18%)
FN3 <466..524 CDD:238020 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.