DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and klg

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:343 Identity:90/343 - (26%)
Similarity:145/343 - (42%) Gaps:70/343 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     3 WCL-------GLAVLSLVISQGADGRGKPEV-VSVVGRA--------------------GESVVL 39
            |.|       |.||.:.:.::|::.|....| .|.|..:                    |:::||
  Fly    56 WLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVL 120

Human    40 GCDLLPPAGRPPLHVIEWLRFGFLLPIFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQG 104
            .|. :...|.   .|:.|.|...:|.        :..|......||||..|.:|:|..|..:|.|
  Fly   121 PCQ-VENLGN---FVLLWRRGTNVLT--------ASNIMVTRDERVRLIDGYNLEISDLEPQDAG 173

Human   105 WYECRVFFLDQHIPEDDFANGSWVH-LTVNSPPQFQETPPA-VLEVQELEPVTLRCVARGSPLPH 167
            .|.|::         .|..|...|| :.:..||..:..|.: .|:.::..|:||.|...|:|:|.
  Fly   174 DYVCQI---------SDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPS 229

Human   168 VTWKLRGKDLGQGQGQVQVQNG-TLRIRRVERGSSGVYTCQASSTEGS-ATHATQLLVLGPPVIV 230
            :.|.   |..|..:...::.:| .|.:.::||..:|||.|.|.:..|. .|...:|.||.||.|.
  Fly   230 IYWT---KKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQ 291

Human   231 VPPKNSTVNASQ--DVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLAT-- 291
            |  :.|.:::.:  :..|.|...|.|. .|.||:|::..:....|     ||:...:.|.:.|  
  Fly   292 V--EKSWIHSGEGFEAKLVCIVFADPV-ATVSWYQNSFPIQSTDR-----RIMATRANRHMLTIR 348

Human   292 --QPDDAGCYTCVPSNGL 307
              |.:|.|.|:||..|.|
  Fly   349 HIQQEDFGNYSCVADNSL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 29/129 (22%)
IG_like 28..110 CDD:214653 24/101 (24%)
I-set 136..223 CDD:254352 25/89 (28%)
Ig 154..220 CDD:143165 20/67 (30%)
Ig_3 226..305 CDD:290638 24/84 (29%)
IG_like 233..319 CDD:214653 22/81 (27%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
klgNP_524454.2 DUF1370 63..>124 CDD:284518 12/61 (20%)
IG_like 109..195 CDD:214653 26/106 (25%)
Ig 118..191 CDD:143165 25/93 (27%)
IG_like 205..274 CDD:214653 20/71 (28%)
IGc2 213..273 CDD:197706 19/62 (31%)
IGc2 301..367 CDD:197706 21/72 (29%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.