DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and dpr16

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:487 Identity:104/487 - (21%)
Similarity:154/487 - (31%) Gaps:159/487 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   136 PQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG-QGQGQVQVQNGTLRIRRVERG 199
            |.|.|..||.|      |..||..:.|:..|        .|:| .|.......|...|:...:..
  Fly   127 PPFPEFIPADL------PHMLRNASSGAAPP--------ADIGPSGSPMPSKPNEQSRLHAYDSE 177

Human   200 SSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQD 264
            .      :|.........|.:..:|....:.:||.|:||.|.|...|.|....: :....||.  
  Fly   178 Q------KAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQHAYLPCKLNQH-SGKPLSWV-- 233

Human   265 NINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMP 329
                    ||:....|.||.:     |..:||...:.:.|..|....|..|..|...|.......
  Fly   234 --------RLRDEHIIAVDHT-----TFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNS 285

Human   330 PETPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYS 394
            ....:|.|..       |.|...|  |||...|.:.|                    ||| |.|.
  Fly   286 FAHAVPGGQE-------RGNSSSL--SWTLQIKYVNL--------------------EDA-GWYE 320

Human   395 CTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEY------FQEVGRELLIPCSAQG--DPPPVVS 451
            |    .|.|. |....:|.|     |:..|:.|.      |.:.|..:.:.|..:|  :.|..:.
  Fly   321 C----QLATE-PKMSAKVQL-----FVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIF 375

Human   452 W---------------------TKVGRGLQGQAQVDSNS--SLILRPLTKEAH-GHWECSASNAV 492
            |                     |::.|.:.|..:.:.|:  ||:: ||.::.| |::.|...|: 
  Fly   376 WYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVI-PLVRKIHSGNYTCEPENS- 438

Human   493 ARVATSTNVYVLGTSPHVVTNVSVVALPKGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDW 557
              .|.|..::||                            .|.....::..|  |.||.|:.|.:
  Fly   439 --AAASMQLHVL----------------------------SGEYSASAIKST--AARPHRLGHGY 471

Human   558 VSLAVPVGAAHLLVPGLQPHTQYQFSVLAQNK 589
            .||                |....|.::|.||
  Fly   472 TSL----------------HQWLIFLLVALNK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 18/87 (21%)
Ig 154..220 CDD:143165 11/66 (17%)
Ig_3 226..305 CDD:290638 19/78 (24%)
IG_like 233..319 CDD:214653 22/85 (26%)
Ig 341..404 CDD:299845 15/62 (24%)
IG_like 431..503 CDD:214653 19/97 (20%)
Ig 436..500 CDD:143165 18/89 (20%)
fn3 511..596 CDD:278470 14/79 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 45/187 (24%)
Ig <298..338 CDD:299845 19/72 (26%)
IG_like 352..447 CDD:214653 19/98 (19%)
Ig 358..439 CDD:143165 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.