DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and CG13506

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:475 Identity:109/475 - (22%)
Similarity:167/475 - (35%) Gaps:98/475 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   129 HLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPH-VTWKLRGKDLGQGQGQV--QVQ--- 187
            |....:||.|..|...| |.:..:.|.|.|.||...|.: |.|......:..||..:  :||   
  Fly    63 HAEQEAPPYFDVTDLRV-EAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCML 126

Human   188 NGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIV------VPPKNSTVNASQDVSL 246
            |.::.:|.|....|..|.|:. ..:....|..  |.:|..:.:      :..::.|........|
  Fly   127 NNSILLRNVSPEDSDDYYCEI-LPQRVRQHTA--LRVGARLSILCDDRDITDRSQTFRQGDHHKL 188

Human   247 ACHAEAYPANLTYSWFQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLHPP 311
            .|.. ..|.|.|..|..:::|.      ||......:|.:.|......:||.|.|:..:|..|||
  Fly   189 ECRT-YLPDNATIKWSFNDLNG------QPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPP 246

Human   312 SASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCPVRANP--PLLFVSWTKDGKALQL-DKF---- 369
            ..:.::.|.|...|:..........|....:.|..||.|  ...|:   ||||.||| ||:    
  Fly   247 HGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFI---KDGKTLQLSDKYSLKD 308

Human   370 PGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGR 434
            ...:.....:||:....:..||||.|...|::|    |...:|.:...|   |.|:.|.....|.
  Fly   309 SVHNDHNRTTLIVREVTDSDLGEYLCQVENAIG----SNEVKVHVSYNP---ETPQFEDMTVEGN 366

Human   435 ELLIPCSAQGDPPPVVSWTKVGRGLQGQAQVD---SNSSLILRPLTKEAHGH------W----EC 486
            ::            .:.|......|..:|.:|   :.|.........|.|.|      |    :.
  Fly   367 KV------------TLHWLVRSHQLLSEAMLDYQLTGSYTWSTVQVLETHRHNNTDNIWKITHQL 419

Human   487 SASNAV--ARVATS--------TNVYV--------------LGTSPHVVTNVSVVALPKGANVSW 527
            ..|..|  |||.|.        :|.:|              :...|..:....::.:.|||..| 
  Fly   420 ELSRGVWHARVKTKNTKGWSHFSNDHVFEIPEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASS- 483

Human   528 EPGFDGGYLQRFSVWYTPLA 547
                    :||.:|....||
  Fly   484 --------MQRLNVGVILLA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 1/2 (50%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 24/92 (26%)
Ig 154..220 CDD:143165 19/71 (27%)
Ig_3 226..305 CDD:290638 16/84 (19%)
IG_like 233..319 CDD:214653 20/85 (24%)
Ig 341..404 CDD:299845 23/69 (33%)
IG_like 431..503 CDD:214653 17/94 (18%)
Ig 436..500 CDD:143165 15/86 (17%)
fn3 511..596 CDD:278470 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/67 (28%)
IGc2 83..146 CDD:197706 17/62 (27%)
IG_like 176..254 CDD:214653 20/84 (24%)
Ig 176..239 CDD:299845 16/69 (23%)
I-set 258..349 CDD:254352 27/97 (28%)
Ig 275..348 CDD:143165 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.