DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and Lac

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:113/296 - (38%) Gaps:52/296 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    65 PIFIQFG--------LYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDD 121
            |:|:..|        .:|.|.||:       .....|||:.::..|.|.|.|:|.....|....:
  Fly    69 PVFLSTGSTLVIKDSRFSLRYDPN-------SSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAE 126

Human   122 FANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQV 186
                  |.|:|..||...:.....:...|...|.:.|.|.|.|.|.:||:.....:........|
  Fly   127 ------VKLSV
RRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYV 185

Human   187 QNGTLRIRRVERGSSGVYTCQASS--TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACH 249
            .| ||||:.|::...|.|.|.|.:  ::|...: ..:.|...|||.||..........|:.|.||
  Fly   186 GN-TLRIKSVKKEDRGTYYCVADN
GVSKGDRRN-INVEVEFAPVITVPRPRLGQALQYDMDLECH 248

Human   250 AEAYPANLTYSWFQDNINV-----FHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLH 309
            .||||.. ...|.:|:|.:     :.||....... ..|.:||::..:....|.|.|..:|..  
  Fly   249 IEAYPPP-AIVWTKDDIQLANNQHYSISHFATADE-YTDSTLRVITVEKRQYGDYVCKATNRF-- 309

Human   310 PPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCP 345
             ..|.|.:.:.          ||.:|:       ||
  Fly   310 -GEAEARVNL
F----------ETIIPV-------CP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 18/74 (24%)
IG_like 28..110 CDD:214653 14/52 (27%)
I-set 136..223 CDD:254352 22/88 (25%)
Ig 154..220 CDD:143165 20/67 (30%)
Ig_3 226..305 CDD:290638 24/83 (29%)
IG_like 233..319 CDD:214653 22/90 (24%)
Ig 341..404 CDD:299845 2/5 (40%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
LacNP_523713.2 IG_like 36..131 CDD:214653 18/74 (24%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353 3/11 (27%)
Ig strand C' 68..72 CDD:409353 1/2 (50%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 11/37 (30%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/11 (9%)
Ig strand G 124..130 CDD:409353 1/11 (9%)
Ig_3 134..208 CDD:404760 22/74 (30%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 3/4 (75%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/3 (0%)
Ig 227..318 CDD:416386 26/95 (27%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.