Sequence 1: | NP_001128522.1 | Gene: | IGSF9 / 57549 | HGNCID: | 18132 | Length: | 1179 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
Alignment Length: | 296 | Identity: | 75/296 - (25%) |
---|---|---|---|
Similarity: | 113/296 - (38%) | Gaps: | 52/296 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 65 PIFIQFG--------LYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDD 121
Human 122 FANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQV 186
Human 187 QNGTLRIRRVERGSSGVYTCQASS--TEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACH 249
Human 250 AEAYPANLTYSWFQDNINV-----FHISRLQPRVRILVDGSLRLLATQPDDAGCYTCVPSNGLLH 309
Human 310 PPSASAYLTVLYPAQVTAMPPETPLPIGMPGVIRCP 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IGSF9 | NP_001128522.1 | Ig | 24..132 | CDD:299845 | 18/74 (24%) |
IG_like | 28..110 | CDD:214653 | 14/52 (27%) | ||
I-set | 136..223 | CDD:254352 | 22/88 (25%) | ||
Ig | 154..220 | CDD:143165 | 20/67 (30%) | ||
Ig_3 | 226..305 | CDD:290638 | 24/83 (29%) | ||
IG_like | 233..319 | CDD:214653 | 22/90 (24%) | ||
Ig | 341..404 | CDD:299845 | 2/5 (40%) | ||
IG_like | 431..503 | CDD:214653 | |||
Ig | 436..500 | CDD:143165 | |||
fn3 | 511..596 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 606..626 | ||||
FN3 | 625..715 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 767..919 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 940..988 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1015..1079 | ||||
PDZ-binding. /evidence=ECO:0000250 | 1177..1179 | ||||
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 18/74 (24%) |
FR1 | 37..50 | CDD:409353 | |||
Ig strand A' | 37..42 | CDD:409353 | |||
Ig strand B | 44..51 | CDD:409353 | |||
CDR1 | 51..59 | CDD:409353 | |||
Ig strand C | 59..63 | CDD:409353 | |||
FR2 | 60..63 | CDD:409353 | |||
CDR2 | 67..81 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 68..72 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 11/37 (30%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/6 (50%) | ||
CDR3 | 116..124 | CDD:409353 | 1/7 (14%) | ||
FR4 | 124..130 | CDD:409353 | 1/11 (9%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/11 (9%) | ||
Ig_3 | 134..208 | CDD:404760 | 22/74 (30%) | ||
Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 166..170 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 187..191 | CDD:409353 | 3/4 (75%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/3 (0%) | ||
Ig | 227..318 | CDD:416386 | 26/95 (27%) | ||
Ig strand C | 256..260 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |