Sequence 1: | NP_001128522.1 | Gene: | IGSF9 / 57549 | HGNCID: | 18132 | Length: | 1179 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723103.1 | Gene: | DIP-theta / 33795 | FlyBaseID: | FBgn0051646 | Length: | 606 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 72/260 - (27%) |
---|---|---|---|
Similarity: | 116/260 - (44%) | Gaps: | 38/260 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 93 LQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHLTVNSPPQFQETPPAV-LEVQELEPVTL 156
Human 157 RCVARGSPLPHVTWKLRGKD---LGQGQGQVQVQNGTLRIRRVERGSSGVYTCQASS-TEGSATH 217
Human 218 ATQLLVLGPPVIVVPPKNSTVNA--SQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRV-- 278
Human 279 ---RILVDGSLRLLATQPD--DAGCYTCVPSNG---------LLHPPSASAYLTVLYPAQVTAMP 329
Human 330 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IGSF9 | NP_001128522.1 | Ig | 24..132 | CDD:299845 | 9/38 (24%) |
IG_like | 28..110 | CDD:214653 | 7/16 (44%) | ||
I-set | 136..223 | CDD:254352 | 28/91 (31%) | ||
Ig | 154..220 | CDD:143165 | 24/69 (35%) | ||
Ig_3 | 226..305 | CDD:290638 | 26/87 (30%) | ||
IG_like | 233..319 | CDD:214653 | 27/103 (26%) | ||
Ig | 341..404 | CDD:299845 | |||
IG_like | 431..503 | CDD:214653 | |||
Ig | 436..500 | CDD:143165 | |||
fn3 | 511..596 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 606..626 | ||||
FN3 | 625..715 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 767..919 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 940..988 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1015..1079 | ||||
PDZ-binding. /evidence=ECO:0000250 | 1177..1179 | ||||
DIP-theta | NP_723103.1 | Ig | 137..230 | CDD:299845 | 10/40 (25%) |
IG_like | 137..230 | CDD:214653 | 10/40 (25%) | ||
IG_like | 240..324 | CDD:214653 | 26/83 (31%) | ||
IGc2 | 247..310 | CDD:197706 | 24/62 (39%) | ||
Ig | 327..419 | CDD:299845 | 27/98 (28%) | ||
IG_like | 343..420 | CDD:214653 | 21/81 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |