DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:334 Identity:85/334 - (25%)
Similarity:135/334 - (40%) Gaps:66/334 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     7 LAVLSLVISQGADGRGKPEVVSVVGR----AGESVVLGCDLLPPAGRPPLHVIEWLRFG--FLLP 65
            |.::||:.:.||   .:||.|..:..    .|......|.:....|    :.:.||:..  .:..
  Fly    28 LLIVSLLEAIGA---FQPEFVESISNVSVAVGRDATFTCHVRHLGG----YRVGWLKADTKAIQA 85

Human    66 IFIQFGLYSPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYEC---------RVFFLDQHIPEDD 121
            |......::||:...::.    |...:|.|:.:..||:|.|.|         ::.|||..||.|.
  Fly    86 IHENVITHNPRVTVSHLD----QNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDF 146

Human   122 FANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRG------KD-LGQ 179
            .:               ::|...|: |.|...|.|.|.|||.|.|.|||:...      || :|.
  Fly   147 IS---------------EDTSSDVI-VPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGT 195

Human   180 GQGQVQVQNGTLRIRRVERGSSGVYTCQASS-TEGSATHATQLLVLGPPVIVVPPKNSTVNA--S 241
            .......:...|::.::.|...|.|.|.||: ...|.:....|.:...|||.||  |..|.|  .
  Fly   196 KTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVP--NQLVGAPLG 258

Human   242 QDVSLACHAEAYPANLTYSWFQDNINV------FHISRLQPRVRILVDGSLRLLAT--QPDDAGC 298
            .||.:.||.||.|.::.| |.:|...:      :|:   |...:.:.:..:.::..  |.||.|.
  Fly   259 TDVQIECHVEASPKSINY-WIKDTGEMIVTSGKYHV---QESSQSMYETKMSMIVRKFQKDDVGS 319

Human   299 YTCVPSNGL 307
            |.|:..|.|
  Fly   320 YRCIAKNSL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/122 (20%)
IG_like 28..110 CDD:214653 16/96 (17%)
I-set 136..223 CDD:254352 27/94 (29%)
Ig 154..220 CDD:143165 22/73 (30%)
Ig_3 226..305 CDD:290638 26/88 (30%)
IG_like 233..319 CDD:214653 23/85 (27%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 16/87 (18%)
Ig 51..131 CDD:299845 16/87 (18%)
I-set 144..240 CDD:254352 28/111 (25%)
IGc2 159..228 CDD:197706 22/68 (32%)
Ig 244..337 CDD:299845 28/91 (31%)
I-set 244..337 CDD:254352 28/91 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.