DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and dpr7

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:278 Identity:66/278 - (23%)
Similarity:105/278 - (37%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   130 LTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG---------QGQGQVQ 185
            ||....|.|.:..|..:.....|...|||..:......|:| :|.:||.         .|..:..
  Fly    45 LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSW-MRKRDLHILTTNIYTYTGDQRFS 108

Human   186 V------QNGTLRIRRVERGSSGVYTCQASSTEGSA-------------------------THAT 219
            |      ::..|:|...:...||||.||. :||...                         |.:.
  Fly   109 VIHPPGSEDWDLKIDYAQPRDSGVYECQV-NTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSA 172

Human   220 QLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANLTYSWFQDNINVFHISRLQPRVRIL--- 281
            :..:||...|.| .::||      ::|||....:..::.  |:..: :|.....|:..:.:.   
  Fly   173 RAKILGSTEIHV-KRDST------IALACSVNIHAPSVI--WYHGS-SVVDFDSLRGGISLETEK 227

Human   282 --VDGSLRLLATQPD--DAGCYTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETPLPI----GM 338
              |..:.||:.|:..  |:|.||||| ||.:   .||..:.||...|..||...:.:.|    .|
  Fly   228 TDVGTTSRLMLTRASLRDSGNYTCVP-NGAI---PASVRVHVLTGEQPAAMQTSSAIRIRAFTAM 288

Human   339 PGVIRCPVRANPPLLFVS 356
            ..:|...|     ||::|
  Fly   289 ITIISTKV-----LLYIS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 1/1 (100%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 25/126 (20%)
Ig 154..220 CDD:143165 21/105 (20%)
Ig_3 226..305 CDD:290638 21/85 (25%)
IG_like 233..319 CDD:214653 23/92 (25%)
Ig 341..404 CDD:299845 5/16 (31%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
dpr7NP_001096850.2 V-set 56..145 CDD:284989 22/90 (24%)
IG_like 58..140 CDD:214653 20/83 (24%)
IG_like 179..265 CDD:214653 25/99 (25%)
Ig 187..257 CDD:299845 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.