DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IGSF9 and dpr9

DIOPT Version :9

Sequence 1:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:85/236 - (36%) Gaps:76/236 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   183 QVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLA 247
            |.|.::..|:|:..:...||:|.||.|:|. ..:|...|.|:.|...::...:..:.:...::|.
  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTP-HMSHYIHLNVV
EPSTEIIGAPDLYIESGSTINLT 384

Human   248 CHAEAYPANLTYSWFQDNINVF--H---ISRLQPRVRILV--------DGSLRLLATQPDDAGCY 299
            |..:..|....|.::..| |.|  |   |:...||..:.|        ...|.:.:.:|.|:|.|
  Fly   385 CIIQNSPEPPAYIFWNHN-NAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHY 448

Human   300 TCVPS------------NGLLHP-----PSASA------------------------------YL 317
            .|.||            ||:.|.     ||::|                              ::
  Fly   449 QCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLGACRWI 513

Human   318 TVLYPAQVTAMPP---------ETPLPIGMPGV--IRCPVR 347
            ..|..|.:...||         |.|   |.||.  |.|.:|
  Fly   514 AALLGAALATPPPLRSTRRATGERP---GSPGCAPIACDMR 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 13/39 (33%)
Ig 154..220 CDD:143165 12/36 (33%)
Ig_3 226..305 CDD:290638 21/103 (20%)
IG_like 233..319 CDD:214653 26/145 (18%)
Ig 341..404 CDD:299845 3/9 (33%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
dpr9NP_001287332.1 Ig 263..361 CDD:299845 13/40 (33%)
IG_like 263..360 CDD:214653 13/39 (33%)
IG_like 371..464 CDD:214653 20/93 (22%)
IGc2 377..456 CDD:197706 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.