DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and Gyc76C

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster


Alignment Length:502 Identity:108/502 - (21%)
Similarity:202/502 - (40%) Gaps:136/502 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   638 RILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIA------GNS----CNI------------ 680
            |::| |.:..|.::...||.:..|...:..|.::.:|      .||    ||.            
  Fly   386 RVID-TIIKNRTYMSITGSKIKIDQYGDSEGNFSVLAYKPHKWNNSNNMPCNYHMVPVAYFHQGE 449

Human   681 KHTEAPLYVVDKPVPEESEGPGSPPP-------YKMIQTIGLSVGAAVAYIIAVLGLMFYCK--- 735
            :|.|..|.......|...|.|...|.       .|...|...|..|||     |||::.:|.   
  Fly   450 EHPEYKLINGSIDWPSGGEKPADEPMCGFANELCKKDDTHYTSTVAAV-----VLGVLLFCSGVI 509

Human   736 --KRCKAKRLQKQPEG-----EEPEMECLNGGPLQNGQPSAEIQEEVALTSLGS-GPAATNKRHS 792
              ...:..:::.:.||     :..|::..:|..:.: .||     :|:|.|..| |...||    
  Fly   510 TMSIYRKWKIELEIEGLLWKIDPNEIKGYSGNEIVS-SPS-----KVSLMSAQSYGSRWTN---- 564

Human   793 TSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSL---QSKDEQQQLDFRRE 854
                        |.:|:.|:                 :...:|.:|.|   :.:|..:::  .:|
  Fly   565 ------------QFVTSTGR-----------------LRGAVVRIKELKFPRKRDISREI--MKE 598

Human   855 LEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALC 919
            :.:..:|.|.|:...:|...|.....:|.:|...|.|...:     ::|.:|...|..   .:|.
  Fly   599 MRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDII-----ENEDIKLDDLFI---ASLI 655

Human   920 TQVALGMEHLSNNRFV-HKDLAARNCLVSAQRQVKVSALGL------SKDVYNSEYYHFRQAWVP 977
            ..:..||.::.|::.| |.:|.:.||:|:::..::|:..||      :::....|:.|:|..   
  Fly   656 HDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESIGEHQHYRNQ--- 717

Human   978 LRWMSPEAI---LEGDFSTKSDVWAFGVLMWEVFTHGEMPHGG-----------------QADDE 1022
             .|.:||.:   :.|  |.|.||:||.::|:|:|:. :.|.|.                 :.:|.
  Fly   718 -LWRAPELLRNHIHG--SQKGDVYAFAIIMYEIFSR-KGPFGQINFEPKEIVDYVKKLPLKGEDP 778

Human  1023 VLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASAL 1069
            ...::::    :.:.|.||..:...::.|||..|::||.||.|.:.|
  Fly   779 FRPEVES----IIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRL 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653
Ig 250..310 CDD:143165
IG 348..416 CDD:214652
IGc2 348..406 CDD:197706
I-set 420..506 CDD:254352
Ig 422..506 CDD:299845
I-set 511..596 CDD:254352
IGc2 528..582 CDD:197706
IG_like 606..689 CDD:214653 16/72 (22%)
IGc2 613..677 CDD:197706 9/44 (20%)
PTK_CCK4 798..1071 CDD:133178 65/302 (22%)
STYKc 809..1069 CDD:214568 62/289 (21%)
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365 13/59 (22%)
ANF_receptor 48..412 CDD:279440 7/26 (27%)
PK_GC-A_B 543..827 CDD:270944 74/339 (22%)
HNOBA <835..881 CDD:285003
CYCc 860..1052 CDD:214485
Guanylate_cyc 887..1074 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.