Sequence 1: | NP_001257327.1 | Gene: | PTK7 / 5754 | HGNCID: | 9618 | Length: | 1078 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723165.2 | Gene: | smal / 5740323 | FlyBaseID: | FBgn0085409 | Length: | 939 | Species: | Drosophila melanogaster |
Alignment Length: | 245 | Identity: | 56/245 - (22%) |
---|---|---|---|
Similarity: | 82/245 - (33%) | Gaps: | 75/245 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 180 GQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVV 244
Human 245 ARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRN------ 303
Human 304 -AGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEER--------------VTCLP 353
Human 354 -PKGLPEPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAA 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PTK7 | NP_001257327.1 | IG_like | 46..120 | CDD:214653 | |
IGc2 | 53..113 | CDD:197706 | |||
Ig2_PTK7 | 154..230 | CDD:143237 | 13/49 (27%) | ||
IG_like | 239..>309 | CDD:214653 | 16/76 (21%) | ||
Ig | 250..310 | CDD:143165 | 15/66 (23%) | ||
IG | 348..416 | CDD:214652 | 16/70 (23%) | ||
IGc2 | 348..406 | CDD:197706 | 16/70 (23%) | ||
I-set | 420..506 | CDD:254352 | |||
Ig | 422..506 | CDD:299845 | |||
I-set | 511..596 | CDD:254352 | |||
IGc2 | 528..582 | CDD:197706 | |||
IG_like | 606..689 | CDD:214653 | |||
IGc2 | 613..677 | CDD:197706 | |||
PTK_CCK4 | 798..1071 | CDD:133178 | |||
STYKc | 809..1069 | CDD:214568 | |||
smal | NP_723165.2 | FA58C | 78..234 | CDD:214572 | |
FA58C | 81..233 | CDD:238014 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |