DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and smal

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_723165.2 Gene:smal / 5740323 FlyBaseID:FBgn0085409 Length:939 Species:Drosophila melanogaster


Alignment Length:245 Identity:56/245 - (22%)
Similarity:82/245 - (33%) Gaps:75/245 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   180 GQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVV 244
            |:|:|:.||.     ....||:|||:|.....:...:|.:......|..:.|.|....|      
  Fly   701 GKSSHSHSSH-----CSTGGPDHSGIYDDGIGTMNSKATAPMINPYSSGNSSSAAAAAA------ 754

Human   245 ARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRN------ 303
            |.::.|..: .|.:.|.   ...||....:. .:.|..:..||..| ||..:.: :|::      
  Fly   755 AEFQRARTY-NFRSYPD---NLXFEASLKLV-AAAPKRITAATASA-GSTTMPK-KPQHLSLVAS 812

Human   304 -AGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEER--------------VTCLP 353
             ||.|.|   |....| ....|||          ..::.|.|...|              |..:|
  Fly   813 TAGGYGC---GTSSKP-KYSLTLH----------NSKLATGGKHLRDGLQQRQHLKAVDGVGLVP 863

Human   354 -PKGLPEPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAA 402
             |..||...|    .||.|.                 |.|:||..|..|:
  Fly   864 VPVTLPVDEV----VGVHLK-----------------AGSEAGAATGEAS 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237 13/49 (27%)
IG_like 239..>309 CDD:214653 16/76 (21%)
Ig 250..310 CDD:143165 15/66 (23%)
IG 348..416 CDD:214652 16/70 (23%)
IGc2 348..406 CDD:197706 16/70 (23%)
I-set 420..506 CDD:254352
Ig 422..506 CDD:299845
I-set 511..596 CDD:254352
IGc2 528..582 CDD:197706
IG_like 606..689 CDD:214653
IGc2 613..677 CDD:197706
PTK_CCK4 798..1071 CDD:133178
STYKc 809..1069 CDD:214568
smalNP_723165.2 FA58C 78..234 CDD:214572
FA58C 81..233 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.