DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and InR

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster


Alignment Length:461 Identity:125/461 - (27%)
Similarity:216/461 - (46%) Gaps:90/461 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   654 NGSLVIHDVA-----PEDSGRYTCIAGNSCN------IKHTEAPLYVVDKPVPEESEGPGS---- 703
            ||.:|.::||     |:......||.....|      ||..|. ||.. :.......|.|.    
  Fly  1235 NGEIVTYEVAYKLQKPDQVEEKKCIPAADFNQTAGYLIKLNEG-LYSF-RVRANSIAGYGDFTEV 1297

Human   704 -------PPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGP 761
                   ||.|..:....|.:|.|. .|:::.|.:.|..||       |.|..:           
  Fly  1298 EHIKVEPPPSYAKVFFWLLGIGLAF-LIVSLFGYVCYLHKR-------KVPSND----------- 1343

Human   762 LQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGL 826
                   ..:..||       .|...:.:: ..|.....|.::..:..||:..||.|:       
  Fly  1344 -------LHMNTEV-------NPFYASMQY-IPDDWEVLRENIIQLAPLGQGSFGMVY------- 1386

Human   827 EEGVAETL--------VLVKSL-QSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMV 882
             ||:.::.        ..:|:: ::..::::.:|..|..:..:.:..:||||||:|...:|..:|
  Fly  1387 -EGILKSFPPNGVDRECAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCSRGQPALVV 1450

Human   883 LEYVDLGDLKQFLRISK--SKDEKLKS-----------QPLSTKQKVALCTQVALGMEHLSNNRF 934
            :|.:..||||.:||..:  .:||.:.:           ||.:..:...:..::|.||.:|:..:|
  Fly  1451 MELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKF 1515

Human   935 VHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYH-FRQAWVPLRWMSPEAILEGDFSTKSDVW 998
            ||:|||||||:|:....||:...|:::|:|.::||. ..:..:|:|||.||::.:|.:|:.|||:
  Fly  1516 VHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVF 1580

Human   999 AFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFS 1063
            :|||::||:.|....|:.|.::::||..:..|.. :.:||.||..|::||||||......||||.
  Fly  1581 SFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGV-MERPENCPDFLHKLMQRCWHHRSSARPSFL 1644

Human  1064 EIASAL 1069
            :|.:.|
  Fly  1645 DIIAYL 1650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653
Ig 250..310 CDD:143165
IG 348..416 CDD:214652
IGc2 348..406 CDD:197706
I-set 420..506 CDD:254352
Ig 422..506 CDD:299845
I-set 511..596 CDD:254352
IGc2 528..582 CDD:197706
IG_like 606..689 CDD:214653 13/45 (29%)
IGc2 613..677 CDD:197706 8/27 (30%)
PTK_CCK4 798..1071 CDD:133178 92/295 (31%)
STYKc 809..1069 CDD:214568 90/282 (32%)
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020 16/68 (24%)
PTKc_InsR_like 1364..1652 CDD:173625 92/296 (31%)
Pkinase_Tyr 1371..1650 CDD:285015 90/287 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.