DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and CG31183

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:1004 Identity:184/1004 - (18%)
Similarity:330/1004 - (32%) Gaps:329/1004 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   254 CQFSAQPPPSLQWLFEDE------------------TPITNRSR----------------PPH-- 282
            |...|...||..|.::.|                  ||.|..|.                |.|  
  Fly    15 CLLQAHLFPSAAWFYDAESVGGVASIGVGSDEHSFKTPETKNSHKSQSTELVQHFPSLPMPDHRR 79

Human   283 --LRRATVFANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGS 345
              .||..||.   .||..|...|..  .||     .|.::....|.:..::.|.      |..||
  Fly    80 LGARRQLVFV---ALLPSVESDNKN--DCI-----MPKVLPVLELAIRHVQRMG------FVGGS 128

Human   346 EERVTCLP----------PKGLPEPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCH 400
            ...:..:.          |.|..|....|       |....|:....|.|||.|:.. |.|:...
  Fly   129 HFDIQLISRDTFCSSKYGPIGFFEIYTQW-------PEVNAVFGLPCEYVLAPISRY-ADVWQVP 185

Human   401 AANLAGQRRQDVNITVATVPSWLKKPQD----SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLIS 461
            .....|..::           :.||.:.    ::|:..:...|..:.:|... :..|.|..::..
  Fly   186 VLTTGGNAKE-----------FNKKSESYSTLTRLKGAQVNNLGNVVRAILN-SFNWTRTALIYQ 238

Human   462 EDSRFEVFKNGTLRINSV---------------EVYD-----GTWYRCMSSTPAGSIEAQARVQV 506
            .:       |..::.|||               .||.     .||.:...:....::..|:|:.:
  Fly   239 NE-------NAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQSRIVI 296

Human   507 LEKLKFTPPPQPQQCMEFDKEATVPCSAT---------------------GREKPTIKWERADG- 549
            :    ...|...:|.|...:|..:..|..                     .:....:..|||.. 
  Fly   297 M----CADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKA 357

Human   550 -----SSLPEWVTDNAGTLHFARVTRD------DAGNYTCIASNGPQGQIRAHVQLTVAVFIT-- 601
                 :..|:...||    .:.||:.:      :..||| .:.|.|           ::.|:|  
  Fly   358 YTAMLTVTPKQPNDN----EYTRVSNEIKAIAAEKYNYT-FSDNEP-----------ISAFVTSF 406

Human   602 --------------FKVEPERTT---------------VYQGHTALLQCEAQGDPKPLIQWKGKD 637
                          .:.:|...|               .:.|.|..:..:|.||......     
  Fly   407 FDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYS----- 466

Human   638 RILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPV-------- 694
             :||   :.|....|:..:..:|:....::.:....||:     ..|||   .|:|:        
  Fly   467 -LLD---MNPTTGRFEIVAHFLHNRLEFEANKEIHWAGD-----REEAP---PDRPICGYDGALC 519

Human   695 PEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEME---- 755
            |:     .|.|.|.::..:       :..::.|:.:.|:...|......:......:..:|    
  Fly   520 PD-----NSLPGYAILSIV-------LGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDVMF 572

Human   756 --CLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFG-- 816
              ....|  ..|...:.:::...||.:.....:.|     .|:..|     .|:....||:..  
  Fly   573 RDAAERG--LRGSFHSLVKQSSQLTLMSEDMVSIN-----GDRQIF-----IPVGMFRKSKVAIK 625

Human   817 EVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYM 881
            .|.:...|||         |.:||.           .||:....|.|.::|:..|.|.:....::
  Fly   626 PVEVDNVQGL---------LTRSLM-----------LELKRMKDLQHDHLVKFYGACLDQRRSFL 670

Human   882 VLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHL-SNNRFVHKDLAARNCL 945
            :.||...|.|:..|     ::|:.:   |....:::|...:..||:.| |::...|.:|.:.||:
  Fly   671 LTEYCPKGSLQDIL-----ENEQFQ---LDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCV 727

Human   946 VSAQRQVKVSALGLSK------DV------YNSEYYHFRQAWVPLRWMSPEAIL-------EGDF 991
            |.::..:|::..||..      |:      .||..|     |..|.|.:||.:.       ||  
  Fly   728 VDSRFVLKITDFGLHTLRRTRFDLESDGGNCNSHAY-----WSKLLWTAPELLRVEHNRPPEG-- 785

Human   992 STKSDVWAFGVLMWEVFTH------GEMPHGGQADDEVLADLQAG----KARLP-----QPEG-C 1040
            :.|.||:|||:::.|:.|.      |...:  :...:.:.:|..|    :.:.|     :|.| .
  Fly   786 TQKGDVYAFGIIVHEITTRQGPFYLGRCAY--EKSPQEIIELVKGYNPHRMQKPFRPELEPNGDT 848

Human  1041 PSKLYRLMQRCWALSPKDRPSFSEIASAL 1069
            .:.:..:::||||..|.:||.|:.:.|.:
  Fly   849 KADINGIIRRCWAEDPAERPDFNTLKSMI 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653 20/92 (22%)
Ig 250..310 CDD:143165 20/93 (22%)
IG 348..416 CDD:214652 14/77 (18%)
IGc2 348..406 CDD:197706 13/67 (19%)
I-set 420..506 CDD:254352 17/109 (16%)
Ig 422..506 CDD:299845 17/107 (16%)
I-set 511..596 CDD:254352 18/117 (15%)
IGc2 528..582 CDD:197706 12/86 (14%)
IG_like 606..689 CDD:214653 17/97 (18%)
IGc2 613..677 CDD:197706 12/63 (19%)
PTK_CCK4 798..1071 CDD:133178 72/310 (23%)
STYKc 809..1069 CDD:214568 70/297 (24%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 76/481 (16%)
ANF_receptor 108..473 CDD:279440 65/426 (15%)
PK_GC-A_B 589..883 CDD:270944 76/336 (23%)
Pkinase_Tyr 613..877 CDD:285015 71/300 (24%)
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.