DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and Gyc32E

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_001097148.1 Gene:Gyc32E / 34553 FlyBaseID:FBgn0010197 Length:1191 Species:Drosophila melanogaster


Alignment Length:692 Identity:129/692 - (18%)
Similarity:235/692 - (33%) Gaps:200/692 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   468 VFKNGTLRINSV--EVYDGTWYRCMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDK---E 527
            :.::|...:.||  |:||                :..||.::|:....|..:.::....||   .
  Fly   263 LLESGDYIVVSVDDEIYD----------------SNRRVNIMERNYLDPYIRKEKSKSLDKISFR 311

Human   528 ATVPCSATGREKPTIKWERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHV 592
            :.:..|.|..:.|.|:       .:...:.|      :||.|......:..:..|........|:
  Fly   312 SVIKISMTYPQNPHIR-------DICSKIKD------YARKTPFLVPYHQRVFDNISVPIYGLHL 363

Human   593 QLTVAVFITFKVEPERT--TVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQ-- 653
            ..:|.:::....|..|.  .:|.|:..:                              .|||.  
  Fly   364 YDSVMIYVRAITEVLRLGGDIYDGNLVM------------------------------SHIFNRS 398

Human   654 ----NGSLVIHDVAPEDSGRYTCI-----AGNSCNI----KHTEAPL--YVVDK--PVPE----E 697
                .|..|..|...:..|.||.|     .|:..:|    |.:..|:  :..||  .:||    :
  Fly   399 YHSIQGFDVYIDSNGDAEGNYTVITLQNDVGSGASIGSLAKMSMQPVGFFAYDKNSVIPEFRYIK 463

Human   698 SEGP-----GSPP-------------PYKMIQTIGLSVGAAVAYIIAV---LGLMFYCKKRCKAK 741
            ::.|     |.||             |.|.:....|..|...|.::.|   |.:..|..::..|.
  Fly   464 NDRPIQWLNGRPPLAEPLCGFHGELCPRKKLDWRYLVSGPLCALVVVVAIALLIKHYRYEQTLAG 528

Human   742 RLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQP 806
            .|.|..                        .::|.:.:||.....|||     :.....|.|:..
  Fly   529 LLWKVD------------------------MKDVTVINLGEYNNPTNK-----NIFQICRQSILV 564

Human   807 ITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLG 871
            :....|..|..:.|.:.         .:|.:|.:..|........|:||::..::.|.|::..:|
  Fly   565 VGEPNKRSFTNIALFRG---------NIVAMKKIHKKSVDITRSIRKELKLMREVRHENIINFIG 620

Human   872 LCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFV- 935
            ...:.....:...|...|.|:..|   .::|..|....:|     :|.:.:..||.:|.::..: 
  Fly   621 ASTDHGSVIIFTTYCARGSLEDVL---ANEDLHLDHMFIS-----SLVSDILKGMIYLHDSEIIS 677

Human   936 HKDLAARNCLVSAQRQVKVSALGL-----SKDVYNSEYYHFRQAWVPLRWMSPEAILE----GDF 991
            |.:|.:.|||:.::...::|..||     .::..|......::|..    |:||.:.:    |..
  Fly   678 HGNLRSSNCLIDSRWVCQISDFGLHELKAGQEEPNKSELELKRALC----MAPELLRDAYRPGRG 738

Human   992 STKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLY----------- 1045
            |.|.||::||:|::|:... :.|.|         |....|..:.|...||..|.           
  Fly   739 SQKGDVYSFGILLYEMIGR-KGPWG---------DTAYSKEEIIQFVKCPEMLQHGVFRPALTHT 793

Human  1046 ---------RLMQRCWALSPKDRPSFSEIASALGDSTVDSKP 1078
                     :.:.:||...|:.||....:...|.:.....||
  Fly   794 HLDIPDYIRKCLCQCWDEDPEVRPDIRLVRMHLKELQAGLKP 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653
Ig 250..310 CDD:143165
IG 348..416 CDD:214652
IGc2 348..406 CDD:197706
I-set 420..506 CDD:254352 8/39 (21%)
Ig 422..506 CDD:299845 8/39 (21%)
I-set 511..596 CDD:254352 13/87 (15%)
IGc2 528..582 CDD:197706 8/53 (15%)
IG_like 606..689 CDD:214653 17/101 (17%)
IGc2 613..677 CDD:197706 12/74 (16%)
PTK_CCK4 798..1071 CDD:133178 61/302 (20%)
STYKc 809..1069 CDD:214568 58/289 (20%)
Gyc32ENP_001097148.1 PBP1_Speract_GC_like 44..448 CDD:107365 41/243 (17%)
ANF_receptor 59..427 CDD:279440 37/222 (17%)
PHA02988 534..826 CDD:165291 66/351 (19%)
PK_GC-A_B 550..832 CDD:270944 64/317 (20%)
HNOBA <847..886 CDD:285003
CYCc 865..1057 CDD:214485
Guanylate_cyc 892..1076 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.