DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and dpr9

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:287 Identity:60/287 - (20%)
Similarity:91/287 - (31%) Gaps:92/287 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   572 DAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTT-------VYQGHTALLQCEAQGDPKP 629
            |:|.|.|..|..|  .:..::.|.|       |||....       :..|.|..|.|..|..|:|
  Fly   338 DSGIYECQVSTTP--HMSHYIHLNV-------V
EPSTEIIGAPDLYIESGSTINLTCIIQNSPEP 393

Human   630 --LIQWKGKDRILDPTKL----GPR--MHIFQN------GSLVIHDVAPEDSGRYTCIAGNSCNI 680
              .|.|...:......::    .||  :.:..|      ..|:|....|.|||.|.|   |..|.
  Fly   394 PAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQC---NPSNA 455

Human   681 KHTEAPLYV-------VDKPVPEESEGPGSPPPYKMIQTIGLSVGAAV-------AYIIAVLGLM 731
            |.....::|       |.:.||..:...|:.....:..::.:.|...|       .:|.|:||..
  Fly   456 KPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLGACRWIAALLGAA 520

Human   732 FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDK 796
            .......::.|   :..||.|            |.|             |..|.|.:.||..:..
  Fly   521 LATPPPLRSTR---RATGERP------------GSP-------------GCAPIACDMRHFLASV 557

Human   797 MHF-----------------PRSSLQP 806
            :.:                 ||..|:|
  Fly   558 LRWQWRWCWRWHWKGTQQQDPRHYLKP 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653
Ig 250..310 CDD:143165
IG 348..416 CDD:214652
IGc2 348..406 CDD:197706
I-set 420..506 CDD:254352
Ig 422..506 CDD:299845
I-set 511..596 CDD:254352 7/23 (30%)
IGc2 528..582 CDD:197706 4/9 (44%)
IG_like 606..689 CDD:214653 24/103 (23%)
IGc2 613..677 CDD:197706 20/77 (26%)
PTK_CCK4 798..1071 CDD:133178 4/26 (15%)
STYKc 809..1069 CDD:214568
dpr9NP_001287332.1 Ig 263..361 CDD:299845 8/31 (26%)
IG_like 263..360 CDD:214653 7/23 (30%)
IG_like 371..464 CDD:214653 23/95 (24%)
IGc2 377..456 CDD:197706 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.