Sequence 1: | NP_001257327.1 | Gene: | PTK7 / 5754 | HGNCID: | 9618 | Length: | 1078 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287332.1 | Gene: | dpr9 / 2768670 | FlyBaseID: | FBgn0038282 | Length: | 602 | Species: | Drosophila melanogaster |
Alignment Length: | 287 | Identity: | 60/287 - (20%) |
---|---|---|---|
Similarity: | 91/287 - (31%) | Gaps: | 92/287 - (32%) |
- Green bases have known domain annotations that are detailed below.
Human 572 DAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTT-------VYQGHTALLQCEAQGDPKP 629
Human 630 --LIQWKGKDRILDPTKL----GPR--MHIFQN------GSLVIHDVAPEDSGRYTCIAGNSCNI 680
Human 681 KHTEAPLYV-------VDKPVPEESEGPGSPPPYKMIQTIGLSVGAAV-------AYIIAVLGLM 731
Human 732 FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDK 796
Human 797 MHF-----------------PRSSLQP 806 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PTK7 | NP_001257327.1 | IG_like | 46..120 | CDD:214653 | |
IGc2 | 53..113 | CDD:197706 | |||
Ig2_PTK7 | 154..230 | CDD:143237 | |||
IG_like | 239..>309 | CDD:214653 | |||
Ig | 250..310 | CDD:143165 | |||
IG | 348..416 | CDD:214652 | |||
IGc2 | 348..406 | CDD:197706 | |||
I-set | 420..506 | CDD:254352 | |||
Ig | 422..506 | CDD:299845 | |||
I-set | 511..596 | CDD:254352 | 7/23 (30%) | ||
IGc2 | 528..582 | CDD:197706 | 4/9 (44%) | ||
IG_like | 606..689 | CDD:214653 | 24/103 (23%) | ||
IGc2 | 613..677 | CDD:197706 | 20/77 (26%) | ||
PTK_CCK4 | 798..1071 | CDD:133178 | 4/26 (15%) | ||
STYKc | 809..1069 | CDD:214568 | |||
dpr9 | NP_001287332.1 | Ig | 263..361 | CDD:299845 | 8/31 (26%) |
IG_like | 263..360 | CDD:214653 | 7/23 (30%) | ||
IG_like | 371..464 | CDD:214653 | 23/95 (24%) | ||
IGc2 | 377..456 | CDD:197706 | 22/81 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |