DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and sid-3

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_510783.2 Gene:sid-3 / 181756 WormBaseID:WBGene00002207 Length:1237 Species:Caenorhabditis elegans


Alignment Length:311 Identity:96/311 - (30%)
Similarity:148/311 - (47%) Gaps:41/311 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   773 EEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEV---FLAKAQGLEEGVAETL 834
            ::|.:.:..|.||    ::|..:|...|...::....:|:..|..|   ...::.|....||   
 Worm    80 KQVYIQADQSMPA----QNSIDEKALIPNEQIKLYELIGEGSFAVVKRGTWTQSNGTHVNVA--- 137

Human   835 VLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLG--------DL 891
              ||.|:........|.|.|.....||.|.:::||.|:.|  :|..||.|..:.|        |.
 Worm   138 --VKILRDISPNIMDDLRVEASHLLKLQHPSLIRLYGIVR--QPAMMVFELCEGGSLLDRLRDDK 198

Human   892 KQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSA-QRQVKVS 955
            |..|.:|:..|               .|.|:|..::.|.:...||:|:||||.|::. :|.||:.
 Worm   199 KAILLVSRLHD---------------YCMQIAKALQFLESKHCVHRDVAARNILLARDERTVKIC 248

Human   956 ALGLSKDVYNSE--YYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQ 1018
            ..||.:.:..:|  |....|..||..|..|||:....||..||||::||.:|||||.||.|..|.
 Worm   249 DFGLMRALKENEQMYTMAPQKKVPFAWCPPEALRHRKFSHASDVWSYGVTIWEVFTFGEEPWVGC 313

Human  1019 ADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASAL 1069
            ...:||.::.||: ||.:|:.|..::|::|:.||..:|.:|..|..|...|
 Worm   314 RAIDVLKNIDAGE-RLEKPKYCSERIYQIMKNCWKFNPAERCKFGAIREDL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653
Ig 250..310 CDD:143165
IG 348..416 CDD:214652
IGc2 348..406 CDD:197706
I-set 420..506 CDD:254352
Ig 422..506 CDD:299845
I-set 511..596 CDD:254352
IGc2 528..582 CDD:197706
IG_like 606..689 CDD:214653
IGc2 613..677 CDD:197706
PTK_CCK4 798..1071 CDD:133178 90/286 (31%)
STYKc 809..1069 CDD:214568 88/273 (32%)
sid-3NP_510783.2 SAM_TNK-like 9..70 CDD:188938
STYKc 107..363 CDD:214568 88/278 (32%)
PTKc_Ack_like 111..365 CDD:270636 89/276 (32%)
SH3 371..421 CDD:214620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.