DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and ptk7

DIOPT Version :9

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:XP_031758570.1 Gene:ptk7 / 100487595 XenbaseID:XB-GENE-5846944 Length:1043 Species:Xenopus tropicalis


Alignment Length:1045 Identity:678/1045 - (64%)
Similarity:811/1045 - (77%) Gaps:22/1045 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    35 GTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDTERRFAQGSSLSFAAVD 99
            |.:.||:|.|||||||||.||.|:||||||.|..|...||.:|.||:|||||:.:|.||:|.|||
 Frog    16 GARAAILFTKQPSSQDALHGRSAILRCEVEDPEGVQFEWLQNGVPVRDTERRYQEGGSLTFTAVD 80

Human   100 RLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHP 164
            |.||.||||||||:..||||.||..|||||||||:|.|.|::|.|.::||..::|.|||||||||
 Frog    81 RKQDGGTFQCVARNPTTGEEGRSNVASFNIKWIESGGVTLQYPGSASDIQSSSRVVLRCHIDGHP 145

Human   165 RPTYQWFRDGTPL-SDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIA 228
            ||..|||||||.| .|||:. ::|:|||.|||..|||:.||.|.||||:|.|..||::||||||.
 Frog   146 RPICQWFRDGTALVDDGQAT-SLSNKERTLTLHSAGPDDSGEYYCCAHNAAGSVCSNRNFTLSII 209

Human   229 DESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGS 293
            ||||.:..:.|:|.||.:.|:|||||||||.|.|:.:|.|||:.|::|:|      |.|||.|||
 Frog   210 DESFPQAAVTPEDQVVNKNEDAMFHCQFSATPAPTQEWFFEDQVPLSNKS------RVTVFQNGS 268

Human   294 LLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP 358
            ||::.||||::|:|.|:|.|.||...:|:|:|.||:|::|....|:|.||.:.:|:.|..|:|||
 Frog   269 LLISSVRPRSSGVYSCVGTGHRGKKAVLKASLRLADIDEMRPLSPQVLTADTFQRIACNRPQGLP 333

Human   359 EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWL 423
            .|:||||..|..:|..|||||.|.|||...|.:.|:|:|.|||||.||:|:|::.|||||||.||
 Frog   334 PPTVWWERDGKPVPAEGRVYQDGTELVFRPITKEDSGIYICHAANKAGERKQELQITVATVPEWL 398

Human   424 KKPQDSQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYR 488
            ::|.||.:||||||:|.||::|:.:|.|.||||...|.:|||||:|.||||:|..||||||..||
 Frog   399 ERPTDSLMEEGKPGFLHCLSRASLEPNVTWYRNTNPIGKDSRFEIFPNGTLKILHVEVYDGITYR 463

Human   489 CMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERADGSSLP 553
            |:|:||||:|:|||||.|.|.|||||.|:||||||.|||.||.||||||:||.|:|.:.|||.||
 Frog   464 CVSATPAGAIDAQARVTVQENLKFTPVPRPQQCMELDKEITVHCSATGRQKPLIQWTKGDGSDLP 528

Human   554 EWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTAL 618
            ..|...||.|||..|||.|||||||||||..||:|||.|||||||.|:||:|||.|||||||||:
 Frog   529 AHVESKAGLLHFQPVTRRDAGNYTCIASNSQQGEIRAAVQLTVAVLISFKIEPENTTVYQGHTAV 593

Human   619 LQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHT 683
            |.|:|.|||.|.|||:.:|.::| .|..||:.|..||||.|:.|:.||:|:|||||||:|:|||.
 Frog   594 LHCQAGGDPTPRIQWQSRDVMVD-VKHYPRIQIMPNGSLAIYRVSNEDAGKYTCIAGNACDIKHR 657

Human   684 EAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPE 748
            :..|||||||....||   :..|||:||||.|||.|||.|||.|||||.|||||.||:|..| ||
 Frog   658 DTFLYVVDKPPGGASE---TDSPYKLIQTIVLSVVAAVTYIIIVLGLMLYCKKRRKARRRDK-PE 718

Human   749 GEEPEMECLNGGP-LQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGK 812
            ||||||||||||. |||||.:|||.|||.||:||      |||||:.||:.|||:||.||||||:
 Frog   719 GEEPEMECLNGGTLLQNGQTTAEIPEEVPLTTLG------NKRHSSGDKITFPRASLHPITTLGR 777

Human   813 SEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAE 877
            .||||||||||...:....|::||||:||::|||.|:||||||:||.||||:|||||:|.|||||
 Frog   778 GEFGEVFLAKAPSADSAAGESVVLVKALQTRDEQLQMDFRRELDMFSKLNHSNVVRLVGQCREAE 842

Human   878 PHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAAR 942
            |||||||||||||||||||||:|:|||.|  |||:|.||:||:|||||||||||:||||||||||
 Frog   843 PHYMVLEYVDLGDLKQFLRISRSRDEKPK--PLSSKHKVSLCSQVALGMEHLSNSRFVHKDLAAR 905

Human   943 NCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEV 1007
            ||||||||.|||||||||||||:|||:..|||.||||||.|||:.|.|||||||||:||||||||
 Frog   906 NCLVSAQRLVKVSALGLSKDVYSSEYHPLRQAKVPLRWMPPEAVQEDDFSTKSDVWSFGVLMWEV 970

Human  1008 FTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDS 1072
            ||.||:|:....|:||||.||.|..:|..||||.|::|||||||||.|||||||||||.:.|||.
 Frog   971 FTLGELPYTSLPDEEVLAGLQNGSLKLAAPEGCSSRIYRLMQRCWAPSPKDRPSFSEIVNTLGDL 1035

Human  1073 TVDSK 1077
            |..||
 Frog  1036 TSSSK 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 IG_like 46..120 CDD:214653 49/73 (67%)
IGc2 53..113 CDD:197706 38/59 (64%)
Ig2_PTK7 154..230 CDD:143237 50/76 (66%)
IG_like 239..>309 CDD:214653 38/69 (55%)
Ig 250..310 CDD:143165 33/59 (56%)
IG 348..416 CDD:214652 36/67 (54%)
IGc2 348..406 CDD:197706 31/57 (54%)
I-set 420..506 CDD:254352 54/85 (64%)
Ig 422..506 CDD:299845 53/83 (64%)
I-set 511..596 CDD:254352 59/84 (70%)
IGc2 528..582 CDD:197706 35/53 (66%)
IG_like 606..689 CDD:214653 48/82 (59%)
IGc2 613..677 CDD:197706 36/63 (57%)
PTK_CCK4 798..1071 CDD:133178 204/272 (75%)
STYKc 809..1069 CDD:214568 195/259 (75%)
ptk7XP_031758570.1 Ig_3 23..94 CDD:404760 48/70 (69%)
Ig strand B 38..42 CDD:409353 2/3 (67%)
Ig strand C 51..55 CDD:409353 0/3 (0%)
Ig strand E 72..76 CDD:409353 2/3 (67%)
Ig strand F 87..92 CDD:409353 4/4 (100%)
Ig 118..211 CDD:416386 56/93 (60%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 2/3 (67%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 198..201 CDD:409353 1/2 (50%)
IG_like 220..293 CDD:214653 43/78 (55%)
Ig strand A' 222..225 CDD:409353 1/2 (50%)
Ig strand B 231..238 CDD:409353 6/6 (100%)
Ig strand C 244..250 CDD:409353 1/5 (20%)
Ig strand C' 252..254 CDD:409353 0/1 (0%)
Ig strand D 260..264 CDD:409353 2/3 (67%)
Ig strand E 267..272 CDD:409353 4/4 (100%)
Ig strand F 280..288 CDD:409353 4/7 (57%)
Ig 317..391 CDD:416386 38/73 (52%)
Ig strand B 322..331 CDD:409353 3/8 (38%)
Ig strand C 335..341 CDD:409353 4/5 (80%)
Ig strand C' 343..345 CDD:409353 1/1 (100%)
Ig strand E 357..363 CDD:409353 3/5 (60%)
Ig strand F 369..378 CDD:409353 5/8 (63%)
Ig strand G 381..391 CDD:409353 4/9 (44%)
Ig strand A 395..397 CDD:409353 1/1 (100%)
Ig strand A' 399..405 CDD:409353 2/5 (40%)
IG_like 401..481 CDD:214653 51/79 (65%)
Ig strand B 412..419 CDD:409353 4/6 (67%)
Ig strand C 425..430 CDD:409353 2/4 (50%)
Ig strand C' 432..435 CDD:409353 0/2 (0%)
Ig strand D 440..444 CDD:409353 3/3 (100%)
Ig strand F 460..468 CDD:409353 4/7 (57%)
Ig strand G 471..482 CDD:409353 7/10 (70%)
Ig_3 490..557 CDD:404760 45/66 (68%)
Ig strand B 503..507 CDD:409353 2/3 (67%)
Ig strand C 516..520 CDD:409353 1/3 (33%)
Ig strand E 536..540 CDD:409353 2/3 (67%)
Ig strand F 550..555 CDD:409353 4/4 (100%)
Ig strand G 564..567 CDD:409353 2/2 (100%)
Ig 577..650 CDD:416386 44/73 (60%)
Ig strand A' 583..586 CDD:409353 1/2 (50%)
Ig strand B 592..599 CDD:409353 3/6 (50%)
Ig strand C 605..610 CDD:409353 3/4 (75%)
Ig strand C' 612..614 CDD:409353 1/1 (100%)
Ig strand D 622..626 CDD:409353 1/3 (33%)
Ig strand E 629..634 CDD:409353 3/4 (75%)
Ig strand F 642..650 CDD:409353 6/7 (86%)
PTK_CCK4 764..1034 CDD:133178 204/271 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 400 1.000 Domainoid score I5982
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43672
Inparanoid 1 1.050 1361 1.000 Inparanoid score I1754
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245153at33208
OrthoFinder 1 1.000 - - FOG0007317
OrthoInspector 1 1.000 - - oto154522
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.