DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK6 and PIN3

DIOPT Version :10

Sequence 1:NP_005966.1 Gene:PTK6 / 5753 HGNCID:9617 Length:451 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:22/114 - (19%)
Similarity:44/114 - (38%) Gaps:24/114 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    12 KYV-GLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERETVES 75
            :|| .|:.|..:.|.:|..:.||...:..|....|:.   ....|..  |..|.||:        
Yeast    57 EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYK---GSCNGRT--GIFPANYV-------- 108

Human    76 EPWFFGCIS----------RSEAVRRLQAEGNATGAFLIRVSEKPSADY 114
            :|.|.|...          :::.::::..:.:|..::..:....||.:|
Yeast   109 KPAFSGSNGPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK6NP_005966.1 SH3_Brk 12..69 CDD:212781 15/57 (26%)
SH2_PTK6_Brk 75..174 CDD:198221 7/50 (14%)
Linker 171..190
PTKc_Srm_Brk 184..444 CDD:133248
PIN3NP_015480.1 SH3 58..110 CDD:473055 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.