DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK6 and PIN3

DIOPT Version :9

Sequence 1:NP_005966.1 Gene:PTK6 / 5753 HGNCID:9617 Length:451 Species:Homo sapiens
Sequence 2:NP_015480.1 Gene:PIN3 / 856277 SGDID:S000006358 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:22/114 - (19%)
Similarity:44/114 - (38%) Gaps:24/114 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    12 KYV-GLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERETVES 75
            :|| .|:.|..:.|.:|..:.||...:..|....|:.   ....|..  |..|.||:        
Yeast    57 EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYK---GSCNGRT--GIFPANYV-------- 108

Human    76 EPWFFGCIS----------RSEAVRRLQAEGNATGAFLIRVSEKPSADY 114
            :|.|.|...          :::.::::..:.:|..::..:....||.:|
Yeast   109 KPAFSGSNGPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK6NP_005966.1 SH3_Brk 12..69 CDD:212781 15/57 (26%)
SH2_PTK6_Brk 75..174 CDD:198221 7/50 (14%)
Linker 171..190
PTKc_Srm_Brk 184..444 CDD:133248
STYKc 192..441 CDD:214568
PIN3NP_015480.1 SH3 58..110 CDD:418401 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.