DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK6 and LSB1

DIOPT Version :9

Sequence 1:NP_005966.1 Gene:PTK6 / 5753 HGNCID:9617 Length:451 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:39/185 - (21%)
Similarity:73/185 - (39%) Gaps:55/185 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    12 KYV-GLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAERETVES 75
            :|| .|:||:::.|.:||.:.||...|..|....|:.   .::...:  |..|.||:        
Yeast    56 EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYR---GKSNNKI--GIFPANYV-------- 107

Human    76 EPWFFGCISRSEAVRRLQAEGNATGAFLIRVS-EKPSADYVLSVRDTQAVRHYKIWRRAGGRLHL 139
            :|.|    :||.:.:..:|..::|   :.|.| ..||.:...|...:|.|               
Yeast   108 KPAF----TRSASPKSAEAASSST---VSRPSVPPPSYEPAASQYPSQQV--------------- 150

Human   140 NEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHE---PEPLPHWDDWERPREEF 191
                   |.|        .:...|...|.|.::.:   |.|.|..:.:::|::::
Yeast   151 -------SAP--------YAPPAGYMQAPPPQQQQAPLPYPPPFTNYYQQPQQQY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK6NP_005966.1 SH3_Brk 12..69 CDD:212781 17/57 (30%)
SH2_PTK6_Brk 75..174 CDD:198221 18/99 (18%)
Linker 171..190 4/21 (19%)
PTKc_Srm_Brk 184..444 CDD:133248 1/8 (13%)
STYKc 192..441 CDD:214568 39/185 (21%)
LSB1NP_011652.1 SH3 55..108 CDD:214620 17/64 (27%)
PRK14971 <100..>156 CDD:237874 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.