DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK6 and Src64B

DIOPT Version :9

Sequence 1:NP_005966.1 Gene:PTK6 / 5753 HGNCID:9617 Length:451 Species:Homo sapiens
Sequence 2:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster


Alignment Length:452 Identity:197/452 - (43%)
Similarity:262/452 - (57%) Gaps:31/452 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    14 VGLWDFKSRTDEELSFRAGDVFHVARKEEQWWW----ATLLDEAGGAVAQGYVPHNYLAERETVE 74
            |.|:|:|||.:.:|||..||...|....|..||    .|...|       |.:|.|::||..:|.
  Fly   101 VALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQE-------GLIPLNFVAEERSVN 158

Human    75 SEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQ-----AVRHYKIWRRAG 134
            ||.|||..:.|.||.:.|.||.|..|.||:|.||.....|.|||:|.:     .|:||:|.....
  Fly   159 SEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDN 223

Human   135 GRLHLNEAVSFLSLPELV-NYHRAQSLSHGLRLAAPCRKHEPEPLPHW-------DDWERPREEF 191
            |..::....:|.||..|| .|.:..:|.....|:.||.|.:|:   .|       |.:|.||.|.
  Fly   224 GGYYIATNQTFPSLQALVMAYSKENALGLCHILSRPCPKPQPQ---MWDLGPELRDKYEIPRSEI 285

Human   192 TLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSV 256
            .|.||||.|.|||||.|.|::.:.||:|.:....:.....|| |...|||.||..::|||||.|.
  Fly   286 QLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQ-EAAIMKKFRHNRLVALYAVCSQ 349

Human   257 GDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVG 321
            .:|:||:.|.|:|||||:.||:.|.:.|...:|:.||.|||.||.||||:..|||||||||:|:|
  Fly   350 EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIG 414

Human   322 ENTLCKVGDFGLARLIKEDVYL-SHDHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQ 385
            ||.:.|:.||||||:|.:|.|. ......|.|||||||:..|.:|.||||||:||||.|:|:.||
  Fly   415 ENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQ 479

Human   386 VPYPGMSNHEAFLRVDAGYRMPCPLE--CPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFT 445
            ||||||.:.|....::.|:|||.|..  .|.::::|:|.||...||:||.|:.|.....||:
  Fly   480 VPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFS 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK6NP_005966.1 SH3_Brk 12..69 CDD:212781 20/58 (34%)
SH2_PTK6_Brk 75..174 CDD:198221 39/104 (38%)
Linker 171..190 7/25 (28%)
PTKc_Srm_Brk 184..444 CDD:133248 130/262 (50%)
STYKc 192..441 CDD:214568 126/251 (50%)
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 19/55 (35%)
SH2_Src_family 158..259 CDD:199827 36/100 (36%)
STYKc 285..537 CDD:214568 126/252 (50%)
PTKc_Src_like 289..538 CDD:270630 125/249 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D248674at33208
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.