DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PTK6 and skb5

DIOPT Version :9

Sequence 1:	NP_005966.1	Gene:	PTK6 / 5753	HGNCID:	9617	Length:	451	Species:	Homo sapiens
Sequence 2:	NP_588016.1	Gene:	skb5 / 2539237	PomBaseID:	SPCC24B10.13	Length:	140	Species:	Schizosaccharomyces pombe

Alignment Length:	54	Identity:	17/54 - (31%)
Similarity:	23/54 - (42%)	Gaps:	3/54 - (5%)

- Green bases have known domain annotations that are detailed below.

Human    14 VGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYL 67
            |.|:||:...|.||.|..|....:. .|....|....|:|.|  ..|.||..::
pombe    86 VALYDFEPLHDNELGFTTGQRLCIL-SESSDGWLIAYDDASG--RSGLVPETFV 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PTK6	NP_005966.1	SH3_Brk	12..69	CDD:212781	17/54 (31%)
		SH2_PTK6_Brk	75..174	CDD:198221
		Linker	171..190
		PTKc_Srm_Brk	184..444	CDD:133248
		STYKc	192..441	CDD:214568
skb5	NP_588016.1	SH3_Nbp2-like	84..138	CDD:212799	17/54 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000006
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000