DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCTD16 and CG14647

DIOPT Version :10

Sequence 1:NP_065819.1 Gene:KCTD16 / 57528 HGNCID:29244 Length:428 Species:Homo sapiens
Sequence 2:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster


Alignment Length:101 Identity:37/101 - (36%)
Similarity:54/101 - (53%) Gaps:6/101 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    20 PNSFPEVVELNVGGQVYFTRHSTLIS-IPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFLFR 83
            ||.:   |:||||||:|.|...||:. .|.|:|.:||. :..:.....:|.:|.:.|||....|.
  Fly    32 PNRW---VKLNVGGQIYATTIDTLVGREPDSMLARMFL-QNGSMKPSERDEQGAYLIDRSPRYFE 92

Human    84 YILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLV 119
            .|::|||..|.|...:....|.|: ||.:|.:..||
  Fly    93 PIINYLRHGQFVCDSNISVLGVLE-EARFFGIFSLV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCTD16NP_065819.1 BTB_POZ_KCTD16 23..125 CDD:349706 35/98 (36%)
H1_KCTD16 160..280 CDD:409030
CG14647NP_649465.6 BTB_POZ_KCTD9 34..134 CDD:349677 35/99 (35%)
YjbI 161..322 CDD:440968
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.