DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RNF150 and SPBP4H10.07

DIOPT Version :9

Sequence 1:	XP_005263207.1	Gene:	RNF150 / 57484	HGNCID:	23138	Length:	460	Species:	Homo sapiens
Sequence 2:	NP_596181.1	Gene:	SPBP4H10.07 / 2541304	PomBaseID:	SPBP4H10.07	Length:	583	Species:	Schizosaccharomyces pombe

Alignment Length:	56	Identity:	19/56 - (33%)
Similarity:	30/56 - (53%)	Gaps:	2/56 - (3%)

- Green bases have known domain annotations that are detailed below.

Human   298 DNCAVCIEGYKPNDVVRIL-PCRHLFHKSCVDPWLL-DHRTCPMCKMNILKALGIP 351
            :.|.||:..::.||..|.| .|.|.||:.|:|.||. ...:||:|:...:.:...|
pombe   523 ERCLVCLSNFELNDECRRLKQCNHFFHRECIDQWLTSSQNSCPLCRTKGVASASTP 578

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RNF150	XP_005263207.1	PA_GRAIL_like	45..215	CDD:239037
		UPF0233	<229..>254	CDD:299753
		zf-RING_2	298..341	CDD:290367	17/44 (39%)
SPBP4H10.07	NP_596181.1	PHA03328	77..>156	CDD:223046
		zf-rbx1	<522..568	CDD:289448	17/44 (39%)
		RING	525..570	CDD:238093	18/44 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	58	1.000	Domainoid score	I3480
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm53615
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910