powered by:
Protein Alignment RNF150 and SPBP4H10.07
DIOPT Version :9
Sequence 1: | XP_005263207.1 |
Gene: | RNF150 / 57484 |
HGNCID: | 23138 |
Length: | 460 |
Species: | Homo sapiens |
Sequence 2: | NP_596181.1 |
Gene: | SPBP4H10.07 / 2541304 |
PomBaseID: | SPBP4H10.07 |
Length: | 583 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 56 |
Identity: | 19/56 - (33%) |
Similarity: | 30/56 - (53%) |
Gaps: | 2/56 - (3%) |
- Green bases have known domain annotations that are detailed below.
Human 298 DNCAVCIEGYKPNDVVRIL-PCRHLFHKSCVDPWLL-DHRTCPMCKMNILKALGIP 351
:.|.||:..::.||..|.| .|.|.||:.|:|.||. ...:||:|:...:.:...|
pombe 523 ERCLVCLSNFELNDECRRLKQCNHFFHRECIDQWLTSSQNSCPLCRTKGVASASTP 578
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
58 |
1.000 |
Domainoid score |
I3480 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm53615 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.