Sequence 1: | XP_011541219.1 | Gene: | DSCAML1 / 57453 | HGNCID: | 14656 | Length: | 2065 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163838.2 | Gene: | dpr21 / 8674044 | FlyBaseID: | FBgn0260995 | Length: | 282 | Species: | Drosophila melanogaster |
Alignment Length: | 243 | Identity: | 56/243 - (23%) |
---|---|---|---|
Similarity: | 89/243 - (36%) | Gaps: | 47/243 - (19%) |
- Green bases have known domain annotations that are detailed below.
Human 466 HRTNQYTMSDGTTISHMNVTGPQIRDGGVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVA 530
Human 531 GRDTLINCRVIGYPYYSIKW--YKDALLLPDNHRQVVFENGTLKLTDVQKG-----------MDE 582
Human 583 GEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPP--ASIGQLLYIPCVVSS-GDMPIRITWRK 644
Human 645 DGQVI-----ISGSGVTIESKEFMSS-LQISSVSLKHNGNYTCIASNA 686 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DSCAML1 | XP_011541219.1 | IG_like | 43..119 | CDD:214653 | |
IGc2 | 43..110 | CDD:197706 | |||
Ig | 125..218 | CDD:299845 | |||
IG_like | 137..209 | CDD:214653 | |||
I-set | 245..323 | CDD:254352 | |||
IGc2 | 252..313 | CDD:197706 | |||
IGc2 | 340..401 | CDD:197706 | |||
I-set | 420..514 | CDD:254352 | 10/47 (21%) | ||
Ig | 420..510 | CDD:299845 | 10/43 (23%) | ||
IGc2 | 531..589 | CDD:197706 | 14/70 (20%) | ||
IG_like | 619..698 | CDD:214653 | 23/75 (31%) | ||
Ig | 627..693 | CDD:143165 | 22/67 (33%) | ||
I-set | 702..797 | CDD:254352 | |||
Ig7_DSCAM | 719..797 | CDD:143211 | |||
I-set | 803..896 | CDD:254352 | |||
Ig | 815..903 | CDD:299845 | |||
FN3 | 899..993 | CDD:238020 | |||
FN3 | 1000..1097 | CDD:238020 | |||
fn3 | 1105..1191 | CDD:278470 | |||
FN3 | 1203..1294 | CDD:238020 | |||
IGc2 | 1318..1382 | CDD:197706 | |||
FN3 | 1396..1486 | CDD:238020 | |||
FN3 | 1500..1572 | CDD:238020 | |||
dpr21 | NP_001163838.2 | Ig | 71..149 | CDD:299845 | 15/77 (19%) |
IG_like | 71..140 | CDD:214653 | 14/68 (21%) | ||
IG_like | 162..249 | CDD:214653 | 24/79 (30%) | ||
IGc2 | 169..242 | CDD:197706 | 23/72 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |