DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAML1 and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:433 Identity:96/433 - (22%)
Similarity:163/433 - (37%) Gaps:106/433 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   238 PTILDGFHSQEVWAGHTVELPCTASGYPIPAIRWL----------------KDGR-PLPADSRWT 285
            |...|...:..|.||..|:|.|:........:.|:                ::.| .:..|....
  Fly    52 PEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDK 116

Human   286 KRITGLTISDLRTEDSGTYICEVTNTFGSAEATGILMVIDPLHV--TLTPKKLKTGIGSTVILSC 348
            .|...|.|::::.||.|.|:|:: ||..:....|.:.|:.|.::  .||...:....|..|.|.|
  Fly   117 HRTWFLHINNVQEEDRGRYMCQI-NTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRC 180

Human   349 ALTGSPEFTIRWYRN--TELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFA 411
            ...||||.||:|.|:  .::|: ::.:.:..|..::|.:....:.|.|||.|.|:          
  Fly   181 KAKGSPEPTIKWKRDDGNKIVI-NKTLEVHDLETDSLELERISRLHMGAYLCIAS---------- 234

Human   412 IIALEDGTPRIVS-------SFSEKVVNP--------GEQFSLMCAAKGAPPPTVTWALDDEPIV 461
                 :|.|..||       .||..|..|        |...:|.|..:..|.....|..:::.::
  Fly   235 -----NGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMI 294

Human   462 RDGS---------HRTNQYTMSDGTTISHMNVTGPQIRDGGVYRCTARNLVGSAEYQARINVRGP 517
            .:.|         |.:.:.||       .:.:|..|..|.|.|:|.|:|..|..:...::.:..|
  Fly   295 TESSKYKTETIPGHPSYKATM-------RLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSP 352

Human   518 PSIR------AMRNITAVAGR-------DTLINCRVIGY----PYYS-IKWYKDALLLPDNHRQV 564
            |:.:      .:|..|..|..       :|.:|...||.    |..| |...|.::....|..::
  Fly   353 PTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEI 417

Human   565 VFENGTLKLT-------DVQKGMDEGEY----------LCSVL 590
              :....|||       |..||...|.:          :|.:|
  Fly   418 --DKSKQKLTGSSPKGFDWSKGKSSGSHGNLMASSWPLICCIL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAML1XP_011541219.1 IG_like 43..119 CDD:214653
IGc2 43..110 CDD:197706
Ig 125..218 CDD:299845
IG_like 137..209 CDD:214653
I-set 245..323 CDD:254352 20/94 (21%)
IGc2 252..313 CDD:197706 17/77 (22%)
IGc2 340..401 CDD:197706 20/62 (32%)
I-set 420..514 CDD:254352 25/117 (21%)
Ig 420..510 CDD:299845 25/113 (22%)
IGc2 531..589 CDD:197706 17/86 (20%)
IG_like 619..698 CDD:214653
Ig 627..693 CDD:143165
I-set 702..797 CDD:254352
Ig7_DSCAM 719..797 CDD:143211
I-set 803..896 CDD:254352
Ig 815..903 CDD:299845
FN3 899..993 CDD:238020
FN3 1000..1097 CDD:238020
fn3 1105..1191 CDD:278470
FN3 1203..1294 CDD:238020
IGc2 1318..1382 CDD:197706
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/96 (22%)
Ig 69..139 CDD:143165 14/69 (20%)
IG_like 165..249 CDD:214653 25/99 (25%)
IGc2 172..237 CDD:197706 21/80 (26%)
IG_like 267..348 CDD:214653 18/87 (21%)
Ig 270..339 CDD:299845 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.