DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAML1 and CG34353

DIOPT Version :9

Sequence 1:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:545 Identity:123/545 - (22%)
Similarity:208/545 - (38%) Gaps:115/545 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   305 ICEVTNTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTEL--- 366
            |..|:..|.|..|..::...:|:.::.: :..|...|.|::|.|.:..:..:.:.|.|...:   
  Fly    65 IAVVSLHFESVSAQSMMTKNEPMFISRS-ETFKFITGETIVLPCEVANTDTYVVAWKRGIAILTA 128

Human   367 ----VLPDEAISIRGLSNETLLITSAQKSHSGAYQC-FATRKAQTAQDFAIIALEDGTPRI--VS 424
                |.||.  .:|.::...|.|..|..:.:|.|.| .||...:.......|.:   .|||  :|
  Fly   129 GSVKVTPDP--RVRLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILV---PPRIHHIS 188

Human   425 SFSEKVVNPGEQFSLMCAAKGAPPPTVTWALDDEPIVRDGSHRTNQYTMSDGTTISHMNVTGPQI 489
            :.....|..|....:.|:|.|.|.|.|||:..:. |:.:|..:.:.:.:|......|        
  Fly   189 TGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN-ILPNGEEKLHSHVLSIENVDRH-------- 244

Human   490 RDGGVYRCTARNLVGS-AEYQARINVRGPPSIRAMRNIT-AVAGRDTLINCRVIGYPYYSIKWYK 552
             .||||.|||.|.||. |..|..::|...|.|...|.:. :..|.:..:.|.|.|.....:.|:|
  Fly   245 -KGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFK 308

Human   553 DALLLPDNHRQVVFENGTLKLTDVQK--GMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFE 615
            |.:.|....|.::...|:.....::|  ..|.|.|.|  :.:.||..::.. :.:...|.:..|.
  Fly   309 DTMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSC--VAENQLGKARKT-LQLSGKPNVAVFN 370

Human   616 FPPASIGQLLY-IPCVVSSGDMPI---RITWRK--DGQVIISGSGVTIESKEFMSSLQISSVSLK 674
            .||.|..:..| |...|.| ..||   ::::||  .|..::   |..|:|....||:..||..:.
  Fly   371 SPPISQYKDRYNISWAVDS-HSPIEEYKLSFRKLPQGHEVV---GNAIDSSSSSSSMSSSSSQMY 431

Human   675 HNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGY----------- 728
            .:|.:       |..:.                 :|..|:.|.:|  :.|..||           
  Fly   432 GSGLH-------AHRIG-----------------SNMGGLSGLSG--SGSYSGYGNVIHWGHNDW 470

Human   729 -----PPPKVMWKHAKGSG------NPQQYHPVPLTGRIQI----LPNS--------------SL 764
                 |...|...:|:|..      :|.|::...:..|.:.    |.||              |.
  Fly   471 RNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSNDGPVDLST 535

Human   765 LIRHVLEED------IGYYLCQASN 783
            .:.|.|.::      :.:|...|.|
  Fly   536 FLNHGLSDNEMRDLSVTFYGSSAIN 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAML1XP_011541219.1 IG_like 43..119 CDD:214653
IGc2 43..110 CDD:197706
Ig 125..218 CDD:299845
IG_like 137..209 CDD:214653
I-set 245..323 CDD:254352 5/17 (29%)
IGc2 252..313 CDD:197706 2/7 (29%)
IGc2 340..401 CDD:197706 16/68 (24%)
I-set 420..514 CDD:254352 30/96 (31%)
Ig 420..510 CDD:299845 29/92 (32%)
IGc2 531..589 CDD:197706 15/59 (25%)
IG_like 619..698 CDD:214653 19/84 (23%)
Ig 627..693 CDD:143165 17/70 (24%)
I-set 702..797 CDD:254352 23/128 (18%)
Ig7_DSCAM 719..797 CDD:143211 20/111 (18%)
I-set 803..896 CDD:254352
Ig 815..903 CDD:299845
FN3 899..993 CDD:238020
FN3 1000..1097 CDD:238020
fn3 1105..1191 CDD:278470
FN3 1203..1294 CDD:238020
IGc2 1318..1382 CDD:197706
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 19/81 (23%)
Ig 103..177 CDD:143165 16/75 (21%)
IG_like 191..269 CDD:214653 26/87 (30%)
IGc2 198..258 CDD:197706 21/69 (30%)
I-set 273..360 CDD:254352 20/89 (22%)
Ig 290..359 CDD:143165 16/71 (23%)
FN3 <466..524 CDD:238020 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.