DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DSCAML1 and Dscam2

DIOPT Version :10

Sequence 1:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:2171 Identity:665/2171 - (30%)
Similarity:1024/2171 - (47%) Gaps:239/2171 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MWLVT---FLLLLDSLHKARPEDVGTSLY---FVNDSLQQVTFSSSVGVVVPCPAAGSPSAALRW 59
            ||:.:   .:|||.:|.....|.....|.   ||.:...:|.||:|.|..:.|.|:|||...:.|
  Fly     1 MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQPTVDW 65

Human    60 YLATGDDIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDNDYFCTAENAAGKIRSPNIRVKAVFR 124
            ..|.|..:.::..:|.|..||||.|.||:.:|::..:|:..|.|.|.|:.|:|.|.:::|:||..
  Fly    66 VHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVSRDVQVRAVVA 130

Human   125 EPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVSW-EKDTVSIIP----EHRFFITYHGGLYI 184
            :.|.|.||...:.||..|:.:|::|:.|:|.|.|||| .:..:.|.|    :.:|.:...|.|.|
  Fly   131 QAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQGDGKFHLLPTGELLI 195

Human   185 SDVQKEDALSTYRCITKHKYSGETRQSNGARLSVT---GLARAADPLCLPDPAESIPTILDGFHS 246
            .::|:.|...::||.:.|:.:.:...|:..||.:.   |:..              |::::....
  Fly   196 HNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIIS--------------PSVVEHTAH 246

Human   247 QEVWAGHTVELPCTASGYPIPAIRWL--KDGRPLPADSRWTKRITG--LTISDLRTEDSGTYICE 307
            .:|.......|.|.|.|.|.|...|.  ....|||..|....|:.|  |.|..:..||||.|.|.
  Fly   247 VQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAVTGEDSGVYKCT 311

Human   308 VTNTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALT--GSP--EFTIRWYRNTELVL 368
            ..|..|.|.|...|.|..|:.|.::|..|...:|.|....|.:|  |||  ...|.||::.. .|
  Fly   312 AGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILWYKDGR-QL 375

Human   369 PDEAISIRGLSNETLLITSAQKSHSGAYQCFATR-KAQTAQDFAIIALEDGTPRIVSSFSEKVVN 432
            |..     |...:||::....:.:.|.|||...| :..|.|..|.:.|.|..|.::.||.|:.:.
  Fly   376 PSS-----GRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLGDAPPVLLYSFIEQTLQ 435

Human   433 PGEQFSLMCAAKGAPPPTVTWALDDEPIVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDGGVYRC 497
            ||...||.|:|.|.|.|.::|.||..|:..:|.....||....|..|||:|::...:.|||.|.|
  Fly   436 PGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVMVEDGGEYAC 500

Human   498 TARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDALLLPDNHR 562
            .|.|..|..::.||:|:.|.|.||.:..:|||:|....:.|.|.|||...|.|.:....|||:.|
  Fly   501 IAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIEEIHWERGGRELPDDIR 565

Human   563 QVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFE--FPPASIGQLL 625
            |.|..:|:|.::.|||..|.|.|.|....:...|..:|..|.|.|||.:.||:  ....::|...
  Fly   566 QRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLSPFQTNILQLNMGDRA 630

Human   626 YIPCVVSSGDMPIRITWRKDGQVIISGSGVTIES-KEFMSSLQISSVSLKHNGNYTCIASNAAAT 689
            .:.|.|..||:|:.|.|||||:.|.....::::. .::.|.|.|.::...|.|||:|:..|:||.
  Fly   631 SLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAE 695

Human   690 VSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHAKG--SGNPQQYHPVPL 752
            |...:.|:|.||||::|:|.:.:....:..:|:|...|.|.|.::||.|.|  ||..::....|.
  Fly   696 VENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPF 760

Human   753 TGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGHA 817
            |   ::|.|.|||::||.|:..|:|||||:||:||.|.|.:.|.|......:|...:.:..||..
  Fly   761 T---KLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDT 822

Human   818 KELNCTARGERPIIIRW-EKGDTVIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVFFSCHA 881
            ..|.|...|::||.|.| ..|...::|....:.::..:...|.|.:.|:::..|..||..:.|.|
  Fly   823 ALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRA 887

Human   882 INSYGEDRGLIQLTVQEPPDPPE-LEIREVKARSMNLRWTQRFDGNSIITGFDIEYKNKS----- 940
            .|.||.|:.|:||.|||||.||. ||...:.:||:|::|..:..|...:|.:.:|::...     
  Fly   888 SNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPP 952

Human   941 ----DSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGP 1001
                |.|   |......|....|.|.:|.||:.|:.|:.:....|||.||:||.:.||...|.||
  Fly   953 ALFVDQW---QQIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGP 1014

Human  1002 PMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGD--SEVYT 1064
            |:.::.:|::|..:.::|.||..||::|.|:||.:||:.:|.| |..|:...:...||  :....
  Fly  1015 PLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSG-NTAYNFTSVSGDGDGGNGELL 1078

Human  1065 LDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRS 1129
            |..|.|||:|.|||||||:.|.||.|....|.|:|||||:|||:||..:::|....:||..||..
  Fly  1079 LSGLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIY 1143

Human  1130 TLNGVLKGYRVIFWSLY--VDGEWGEMQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSS 1192
            ..||:|:||::||..:.  :.....|:::..||...:.|.|:.|:||||:||||:|:.||||.|.
  Fly  1144 HTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSK 1208

Human  1193 VLYIQTKEDVPGPPAGIKAVPSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSP 1257
            .|:..::||||..||.||.|.||:.|:.:|||||.:|||||.||:::.......:...:|..:.|
  Fly  1209 PLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVNGREELNNEKRSLP 1273

Human  1258 -EQLFYRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRL 1321
             :|.:|....|:...:|..||.|.|..|.|.||...:.....:.||:||||||.|..||...|.|
  Fly  1274 SQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTL 1338

Human  1322 PCNSVGDPAPAVKWTKDSEDSAIPVSMDGHRLIHT-----NGTLLLRAVKAEDSGYYTCTATNTG 1381
            ||.:||.|..  :|.|    |.:.:...|   :|.     :|.|::.:::..|.|.|:|...|..
  Fly  1339 PCTAVGKPKR--EWFK----SDVALRQGG---LHNSQLLDSGDLIISSLQLADGGNYSCQVDNGI 1394

Human  1382 GFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSSIRGFVLQY--SVDNSEEWKDVF 1444
            |.|.:...|:|||||..|.|.|:..::|||.:.|..|..|.:.|.|:.|.|  :..|::|.:   
  Fly  1395 GTDRLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITGYTLFYRRANGNTDEMQ--- 1456

Human  1445 ISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHAR 1509
            :|....|.:|..|.||:.|::.|:|:|.||:...|.|:..:|.|:.|.......|... |||...
  Fly  1457 LSRHASSHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQGQSPGHPASTALLAP-NSTSLL 1520

Human  1510 LNLQGWNNGGCPITAIVLEYR-----PKGTWAWQGLRANSSGEVFLTELREATWYELRMRACNSA 1569
            :.|..|.:.|||:...||:||     |...|............:.:..|:.:|.|:|||.|.|.|
  Fly  1521 VRLHSWPDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKPQRRIVINNLQPSTLYQLRMEAHNVA 1585

Human  1570 GCGNETAQFATLDYDGSTIPPIKSAQGEGDDVKKLF---TIGCPVILATLGV--ALLFIVRKKRK 1629
            |.......|.||..||...||....:|.......:|   .:..|.|.|..|:  .::.|:...| 
  Fly  1586 GISQAEFNFVTLTKDGDPPPPEIMHRGRSGQTTVIFANINLLIPTIAAVSGMFCTIIMIIVCYR- 1649

Human  1630 EKRLKRLRDAKSLAEM-LISK---NNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDD 1690
                ..|::|..|||. .|.|   .||:.....    |..|.:..|.:|.:...||         
  Fly  1650 ----HMLKNAPPLAEQSQIQKESLENRANSEAA----QRERYYATIHKVSMQNNDK--------- 1697

Human  1691 KATIPVTDAEFSQAVNPQSFCTGVSLHHP-------TLIQSTGPLIDMSDIRPGTN---PVSRKN 1745
               ||.|..:.|.....|....|.::..|       ||:.|.  :.....:..|.:   |.:.||
  Fly  1698 ---IPETSEDISPYATFQLSEAGGNMSQPHHGGPANTLLHSF--MYHERALAEGCSSPPPAASKN 1757

Human  1746 VKSAHSTRNRYSSQWTLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQDTDKGRNSM 1810
             :..||.:....|:      ::.:....|||                 |.:.|.:|...|.::|:
  Fly  1758 -RRRHSRKTEPESE------ESESDQDQLTS-----------------SRTESSNQHEGKIKHSI 1798

Human  1811 VSTESASSTYEELARAYEHAKL----EEQLQHAKFEI-TECFISDSSSDQMTTGT--NENADSMT 1868
            :...:.|||..:|:...|...|    ..:..|.:::. |.......:|::|...|  |.|..:..
  Fly  1799 IYHGAQSSTSSDLSPMSEQKSLPRRGRSRYHHQQYQFSTNTTPRHHNSNKMNNNTTSNTNTTATN 1863

Human  1869 SMSTPSEPGICRFTASPPKPQDADRGKNV-AVPIPHRANKSDYCNLPLYAKSEAFFRKADGREPC 1932
            :.:|||.........||       ||.|: ::....::..|..|::|...||.:...:..     
  Fly  1864 TTATPSTSSNSNKILSP-------RGGNLKSISSTFKSQDSIQCHIPTLVKSPSISTQQQ----- 1916

Human  1933 PVVPPREASIRNLARTYHTQARHLTLDPASKSLGLPHP---------------------GAPAAA 1976
                 ::...:.|..:....::|.:.:|.|.||....|                     |...:.
  Fly  1917 -----KQFHKQQLQNSSTNNSQHSSSNPNSSSLKQQQPLLITPKLHQLEANGQELLGLDGIGNSP 1976

Human  1977 STATLPQRTLAMPAP-----PAGTAP------------------PAPGPTPAEPPTAPSA----- 2013
            ..|.:|..:...|.|     ||...|                  ..|| |...|.||..:     
  Fly  1977 LVACMPPSSQFRPIPHKSIMPAHEPPHHHNHSQQSHPHQQQQQQQHPG-TLLNPSTAMLSSKFFT 2040

Human  2014 APPAPSTEPPRAGGPHTKMGGSRDSL 2039
            ||..|..:....|..:  :||:.:::
  Fly  2041 APTLPKXDTANGGSEY--VGGAMEAM 2064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DSCAML1XP_011541219.1 Ig 27..122 CDD:472250 34/94 (36%)
Ig strand B 43..47 CDD:409353 0/3 (0%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 80..84 CDD:409353 3/3 (100%)
Ig strand F 100..105 CDD:409353 2/4 (50%)
Ig strand G 113..117 CDD:409353 1/3 (33%)
Ig 130..218 CDD:472250 28/92 (30%)
Ig strand B 142..146 CDD:409353 1/3 (33%)
Ig strand C 158..162 CDD:409353 4/4 (100%)
Ig strand E 180..184 CDD:409353 2/3 (67%)
Ig strand F 195..200 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 1/2 (50%)
I-set 245..323 CDD:400151 27/81 (33%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand F 303..308 CDD:409353 2/4 (50%)
Ig strand G 317..320 CDD:409353 1/2 (50%)
Ig 326..415 CDD:472250 27/93 (29%)
Ig strand B 344..348 CDD:409353 0/3 (0%)
Ig strand C 357..361 CDD:409353 1/3 (33%)
Ig strand E 381..385 CDD:409353 2/3 (67%)
Ig strand F 395..400 CDD:409353 3/4 (75%)
Ig strand G 408..411 CDD:409353 1/2 (50%)
Ig 419..514 CDD:472250 35/94 (37%)
Ig strand B 437..441 CDD:409353 2/3 (67%)
Ig strand C 450..454 CDD:409353 0/3 (0%)
Ig strand E 480..484 CDD:409353 2/3 (67%)
Ig strand F 494..499 CDD:409353 2/4 (50%)
Ig strand G 507..510 CDD:409353 0/2 (0%)
Ig 517..605 CDD:472250 32/87 (37%)
Ig strand B 534..538 CDD:409353 0/3 (0%)
Ig strand C 547..551 CDD:409353 1/3 (33%)
Ig strand E 569..573 CDD:409353 2/3 (67%)
Ig strand F 584..589 CDD:409353 2/4 (50%)
Ig strand G 598..601 CDD:409353 0/2 (0%)
Ig 608..698 CDD:472250 30/92 (33%)
Ig strand B 625..629 CDD:409353 0/3 (0%)
Ig strand C 639..643 CDD:409353 1/3 (33%)
Ig strand E 664..668 CDD:409353 2/3 (67%)
Ig strand F 678..683 CDD:409353 3/4 (75%)
Ig strand G 691..694 CDD:409353 0/2 (0%)
Ig_DSCAM 701..797 CDD:409397 39/97 (40%)
putative Ig strand A 701..705 CDD:409397 3/3 (100%)
putative Ig strand A' 710..714 CDD:409397 0/3 (0%)
putative Ig strand B 716..726 CDD:409397 2/9 (22%)
putative Ig strand C 732..738 CDD:409397 2/5 (40%)
putative Ig strand C' 745..748 CDD:409397 0/2 (0%)
putative Ig strand D 757..760 CDD:409397 0/2 (0%)
putative Ig strand E 762..768 CDD:409397 3/5 (60%)
putative Ig strand F 775..783 CDD:409397 6/7 (86%)
putative Ig strand G 788..797 CDD:409397 3/8 (38%)
Ig_DSCAM 798..898 CDD:409398 28/100 (28%)
putative Ig strand A 798..801 CDD:409398 0/2 (0%)
putative Ig strand A' 809..813 CDD:409398 0/3 (0%)
putative Ig strand B 816..823 CDD:409398 1/6 (17%)
putative Ig strand C 831..837 CDD:409398 2/6 (33%)
putative Ig strand C' 847..850 CDD:409398 0/2 (0%)
putative Ig strand D 856..860 CDD:409398 1/3 (33%)
putative Ig strand E 862..868 CDD:409398 1/5 (20%)
putative Ig strand F 875..883 CDD:409398 2/7 (29%)
putative Ig strand G 886..896 CDD:409398 5/9 (56%)
FN3 <895..1208 CDD:442628 126/326 (39%)
fn3 <1223..1289 CDD:394996 23/66 (35%)
Ig_3 1303..1379 CDD:464046 27/80 (34%)
FN3 1396..1486 CDD:238020 30/91 (33%)
FN3 1500..1572 CDD:238020 24/76 (32%)
Dscam2NP_001261500.1 Ig 30..128 CDD:472250 34/97 (35%)
Ig strand B 49..53 CDD:409353 0/3 (0%)
Ig strand C 62..66 CDD:409353 0/3 (0%)
Ig strand E 86..90 CDD:409353 3/3 (100%)
Ig strand F 106..111 CDD:409353 2/4 (50%)
Ig strand G 119..123 CDD:409353 1/3 (33%)
V-set 138..229 CDD:462230 27/90 (30%)
Ig 238..327 CDD:472250 28/88 (32%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 293..297 CDD:409353 1/3 (33%)
Ig strand F 307..312 CDD:409353 2/4 (50%)
Ig strand G 320..323 CDD:409353 1/2 (50%)
Ig 330..418 CDD:472250 27/93 (29%)
Ig strand B 348..352 CDD:409353 0/3 (0%)
Ig strand C 365..369 CDD:409353 1/3 (33%)
Ig strand E 383..387 CDD:409353 2/3 (67%)
Ig strand F 397..402 CDD:409353 3/4 (75%)
Ig strand G 411..414 CDD:409353 1/2 (50%)
IgI_4_Dscam 422..517 CDD:409548 35/94 (37%)
Ig strand A 422..425 CDD:409548 1/2 (50%)
Ig strand A' 431..435 CDD:409548 1/3 (33%)
Ig strand B 438..447 CDD:409548 3/8 (38%)
Ig strand C 452..458 CDD:409548 2/5 (40%)
Ig strand C' 460..463 CDD:409548 0/2 (0%)
Ig strand D 468..476 CDD:409548 2/7 (29%)
Ig strand E 480..489 CDD:409548 4/8 (50%)
Ig strand F 496..504 CDD:409548 4/7 (57%)
Ig strand G 507..517 CDD:409548 3/9 (33%)
IgI_5_Dscam 521..608 CDD:409550 32/86 (37%)
Ig strand A 521..523 CDD:409550 1/1 (100%)
Ig strand A' 528..532 CDD:409550 1/3 (33%)
Ig strand B 535..542 CDD:409550 0/6 (0%)
Ig strand C 549..555 CDD:409550 2/5 (40%)
Ig strand C' 556..558 CDD:409550 0/1 (0%)
Ig strand D 565..569 CDD:409550 2/3 (67%)
Ig strand E 572..578 CDD:409550 2/5 (40%)
Ig strand F 586..594 CDD:409550 3/7 (43%)
Ig strand G 598..608 CDD:409550 3/9 (33%)
Ig 611..704 CDD:472250 30/92 (33%)
Ig strand B 630..634 CDD:409353 0/3 (0%)
Ig strand C 644..648 CDD:409353 1/3 (33%)
Ig strand E 670..674 CDD:409353 2/3 (67%)
Ig strand F 684..689 CDD:409353 3/4 (75%)
Ig strand G 697..700 CDD:409353 0/2 (0%)
IgI_7_Dscam 707..802 CDD:409546 39/97 (40%)
Ig strand A 707..711 CDD:409546 3/3 (100%)
Ig strand A' 716..720 CDD:409546 0/3 (0%)
Ig strand B 723..732 CDD:409546 2/8 (25%)
Ig strand C 738..744 CDD:409546 2/5 (40%)
Ig strand C' 750..753 CDD:409546 1/2 (50%)
Ig strand D 761..764 CDD:409546 1/5 (20%)
Ig strand E 767..773 CDD:409546 3/5 (60%)
Ig strand F 780..788 CDD:409546 6/7 (86%)
Ig strand G 793..802 CDD:409546 3/8 (38%)
Ig 806..892 CDD:472250 21/85 (25%)
Ig strand B 823..827 CDD:409353 1/3 (33%)
Ig strand C 836..840 CDD:409353 1/3 (33%)
Ig strand E 868..872 CDD:409353 1/3 (33%)
Ig strand F 882..887 CDD:409353 1/4 (25%)
FN3 <904..1195 CDD:442628 108/294 (37%)
FN3 906..1006 CDD:238020 30/102 (29%)
fn3 1221..1306 CDD:394996 32/84 (38%)
Ig 1336..1396 CDD:409353 19/68 (28%)
Ig strand B 1336..1340 CDD:409353 2/3 (67%)
Ig strand E 1371..1375 CDD:409353 2/3 (67%)
Ig strand F 1385..1390 CDD:409353 2/4 (50%)
FN3 <1407..>1606 CDD:442628 65/202 (32%)
fn3 1408..1491 CDD:394996 29/85 (34%)

Return to query results.
Submit another query.